Jun-16 | Wolf Theiss | Wolf Theiss advised joint lead managers Banca IMI, Citi Bank, JP Morgan, and Raiffeisen Bank International on the Republic of Albania's EUR 650 million seven-year international bond issuance. | EUR650million | Albania | Here |
11-Dec | Bird & Bird; Clifford Chance; Karanovic & Partners | Clifford Chance advised the Aricoma Group on the acquisition of the Seavus technology company. Karanovic & Partners advised Aricoma on Serbia, Bosnia and Herzegovina, and Albanian elements of the deal. Seavus was advised by Bird & Bird's Stockholm office. | N/A | Albania; Bosnia and Herzegovina; Czech Republic; Serbia | Here |
2-Jan | Binder Grosswang; CMS; Frotz Riedl; Schoenherr | Binder Groesswang and Schoenherr have advised Austria's Wiesenthal AG and Wiesenthal Holding on the sale of Wiesenthal & Co GmbH, including Wiesenthal Handel und Service GmbH, to Switzerland's Mercedes Benz Automobil AG. Switzerland's Frotz Riedl law firm and CMS Vienna advised the buyers on the transaction, which is expected to close in June 2020. | N/A | Austria | Here |
2-Jan | Dorda; Schoenherr | Dorda advised DLH Real Estate Austria, a company owned by the Zech Group, on the sale of two logistics properties and the forward sale of two additional logistics properties to Germany's Deka Immobilien. The buyers were advised by Schoenherr. | N/A | Austria | Here |
3-Jan | Dorda; Schoenherr | Dorda advised Patrizia AG on the sale of Zentrum Rennweg to Swiss Life Living + Working via a structured bidding process. Schoenherr advised Swiss Life Living + Working. | EUR52million | Austria | Here |
15-Jan | Garger Spallinger; Garrigues; Wolf Theiss | Wolf Theiss and Garrigues advised the shareholders of Tag Systems S.A. on the sale of the company to Austriacard and their entrance into a joint venture with Austriacard. The buyers were advised by Garger Spallinger. | N/A | Austria | Here |
15-Jan | Dorda; Schoenherr | Schoenherr advised Noella GmbH, an Austria-based company engaged in manufacturing and distribution of clothes for children, on its acquisition by Michael Pachleitner Group GmbH. Dorda advised the buyers. | N/A | Austria | |
17-Jan | Lattenmayer, Luks & Enzinger; Wolf Theiss | Wolf Theiss advised the REWE group on the sale of a property in the Donaustadt district of Vienna. The successful bidder, BUWOG, was advised by Lattenmayer Luks & Enzinger. | N/A | Austria | Here |
17-Jan | Brandl & Talos | Brandl & Talos supported APEX Ventures in the creation of the APEX Digital Health venture capital fund, designed for investments in new companies with unique technologies and applications in the healthcare sector. | N/A | Austria | Here |
20-Jan | Fellner Wratzfeld & Partner | Fellner Wratzfeld & Partner advised Bundesimmobiliengesellschaft on the structuring and procurement of an "innovation partnership'' in Austria. | N/A | Austria | Here |
22-Jan | Brandl & Talos; Herbst Kinsky; Schnittker Mollmann | Brandl & Talos advised Anyline on its generation of USD 12 million in growth capital through a Series A round of financing. Lead investors Project A and Senovo were advised by Herbst Kinsky and Schnittker Mollmann Partners, respectively. | USD12million | Austria | Here |
23-Jan | CMS; KPMG Legal; Schoenherr | KPMG Law advised the shareholders of Barracuda Holding GmbH on the sale of 71% of the shares in the company to the CTS Eventim Group. The buyers were advised by CMS and Schoenherr. | N/A | Austria | Here |
24-Jan | CMS; Schoenherr | CMS advised Encavis Infrastructure Fund III on its acquisition of the Furstkogel wind farm in Austria, consisting of five wind turbines with a total rated output of 17.25 MW. The sellers, wind energy specialist Ecowind Handels- & Wartungs-GmbH, were advised by Schonherr. | N/A | Austria | Here |
27-Jan | DSC Doralt Seist Csoklich; Linklaters; Wolf Theiss | Wolf Theiss and Linklaters advised J.P. Morgan and Erste Group Bank AG as joint book-runners on S Immo AG's issuance of 6,691,717 new shares via an accelerated book-building procedure involving the exclusion of shareholders' subscription rights. S Immo AG was advised by DSC Doralt Seist Csoklich. | N/A | Austria | Here |
27-Jan | Fellner Wratzfeld & Partner | Fellner Wratzfeld & Partner advised Bundesimmobiliengesellschaft m.b.H. on the structuring and procurement of an "innovation partnership" with several enterprises in Austria. | N/A | Austria | Here |
28-Jan | Herbst Kinsky; Weber & Co. | Weber & Co. advised Erste Group Bank AG as the sole bookrunner on the sale of 105,000 Marinomed Biotech AG shares by shareholders Acropora Beteiligungs GmbH, VETWIDI Forschungsholding GmbH, and BVT Beteiligungsverwaltung und Treuhand GmbH. Herbst Kinsky advised Marinomed on the sale. | EUR10million | Austria | Here |
28-Jan | Weber & Co.; Wolf Theiss | Weber & Co. advised DekaBank Deutsche Girozentrale, DZ Bank, Erste Group, RBI, and UniCredit as joint lead managers on the successful issuance of mortgage covered bank bonds by Raiffeisenlandesbank Oberosterreich AG. Wolf Theiss advised Raiffeisenlandesbank Oberosterreich on the issuance. | EUR500Million | Austria | Here |
29-Jan | Schoenherr | Schoenherr helped UniCredit Bank establish its Social Impact Banking initiative in Austria. | N/A | Austria | Here |
31-Jan | Linklaters; Rautner Attorneys At Law; Weber & Co.; Wolf Theiss | Wolf Theiss advised Erste Group Bank AG on the issue of EUR 500 million of Additional Tier 1 Notes and on the issue of EUR 750 million Mortgage Pfandbriefe. Linklaters and Rautner Rechtsanwalte advised lead managers HSBS, BofA Securities, Morgan Stanley, and Societe Generale on the Tier 1 note issuance. Weber & Co advised Banca IMI, Danske Bank, DekaBank, DZ BANK, Erste Group (in its capacity as Manager), and LBBW on the Mortgage Pfandbriefe. | 1.2billion | Austria | Here |
31-Jan | White & Case; Wolf Theiss | Wolf Theiss and White & Case advised joint lead managers ABN Amro, Deutsche Bank, DZ Bank AG, RBI, and UniCredit on UniCredit Bank Austria AG's successful January 21, 2020 placement of a benchmark EUR 500 million issuance of mortgage securities. | EUR500million | Austria | Here |
31-Jan | Bc& Studio Di Consulenza Societaria Tributaria Legale; Brandl & Talos | Brandl & Talos advised founders Simon Falkensteiner and Matthias Trenkwalder and investors including aws Gruenderfonds, Falkensteiner Ventures, and Nextfloor Ventures on the sale of RateBoard, a developer of a revenue management software for the hotel industry, to Zucchetti, an Italian software developer in the field of hospitality and restaurant industry. Zuchetti was advised by BC& Studio di Consulenza Societaria Tributaria Legale and Solo Practitioner Mario Perl. | N/A | Austria | Here |
7-Feb | Brandl & Talos; Leitner Law | Brandl & Talos advised Aws Mittelstandsfonds on an unspecified investment in Communi5 Technologies GmbH. Leitner Law advised Communi5 on the deal. | N/A | Austria | Here |
13-Feb | Wolf Theiss | Wolf Theiss advised Raiffeisen Bank International AG on the issuance of Ordinary Senior Eligible bonds worth EUR 750 million under its EUR 25 million Debt Issuance Program. Banco Santander, S.A., BNP Paribas, Citigroup Global Markets Limited, Morgan Stanley & Co International, and RBI were joint lead managers. | EUR750million | Austria | Here |
24-Feb | Allen & Overy | Allen & Overy advised Oesterreichische Kontrollbank on legal aspects of its public offering of USD 1.5 billion of 1.500% Guaranteed Global Notes due 2025. | USD1.5billion | Austria | Here |
25-Feb | CMS; Herbst Kinsky | CMS Austria advised Topinstallateur GmbH on the acquisiton of a majority stake in the company by Germany's Auctus investment fund. Auctus was advised by Herbst Kinsky. | N/A | Austria | Here |
25-Feb | Cerha Hempel | Cerha Hempel advised KTM AG on its establishment of a joint venture with Spanish engine manufacturer GasGas Motorcycles S.L. | N/A | Austria | Here |
4-Mar | Brandl & Talos; Herbst Kinsky; Schoenherr | Brandl & Talos advised Ready2order on its EUR 5 million investment round, which was led by Reimann Investors and Speedinvest, which were advised by Schoenherr and Herbst Kinsky. | EUR5million | Austria | Here |
11-Mar | Dorda | Dorda advised China's Weichai Group on its acquisition of 51% of the VDS Group, an Upper-Austrian transmissions specialist. SCWP Schindhelm advised the sunidentified sellers on the deal. | N/A | Austria | Here |
11-Mar | Dorda | Dorda advised GalCap on the acquisition of a mixed-use building at Pohlgasee 26 in Vienna-Meidling from UBM and Invester. UBM was advised by solo practitioner Jakob Molzbichler. | N/A | Austria | Here |
11-Mar | Schoenherr | Schoenherr advised Austria's HS Timber Group and Blue Minds IF on their February 28, 2020 acquisition of Interfloat Corporation and GMB Glasmanufaktur Brandenburg GmbH. | N/A | Austria | Here |
12-Mar | Brandl & Talos; Gross Hofer; Schnittker Moellmann Partners; Willkie Farr & Gallagher | Brandl & Talos, Willkie Farr & Gallagher, and Germany's Schnittker Moellmann Partners advised Insight Partners and e.ventures on the EUR 30 million series A investment in Viennese start-up PlanRadar. Grohs Hofer advised PlanRadar. | EUR30million | Austria | Here |
12-Mar | Cleary Gottlieb Steen & Hamilton; Schoenherr | Schoenherr and Cleary Gottlieb advised Google LLC on the acquisition of Looker Data Sciences. | N/A | Austria | |
13-Mar | Hochedlinger Luschin Marenzi Kapsch; Schoenherr | Schoenherr advised Neuraxpharm, a portfolio company of Apax Partners, on the acquisition of Austrian consumer healthcare company Easypharm OTC GmbH. Hochedlinger Luschin Marenzi Kapsch advised the unidentified sellers on the deal. | N/A | Austria | Here |
16-Mar | DLA Piper | DLA Piper advised PORR AG on the issuance of EUR 150 million hybrid bond. | EUR150million | Austria | Here |
16-Mar | Cerha Hempel; Linklaters | Cerha Hempel advised CA Immobilien Anlagen AG on its EUR 500 million benchmark bond issuance. Linklaters advised sole global coordinator J.P. Morgan and joint book-runners Erste Group, J.P. Morgan, and Morgan Stanley. | EUR500million | Austria | Here |
17-Mar | Act Legal (WMWP); Herbst Kinsky | Herbst Kinsky advised Earlybird Venture Capital on its investment into Mostly AI Solutions MP GmbH. Act Legal advised Mostly AI. | N/A | Austria | Here |
23-Mar | Binder Groesswang; Schoenherr | Binder Groesswang advised Austrian risk and insurance manager GrECo and its majority owners, the Neubrand family, on the buy-back of GrECo shares from former partner JLT. Schoenherr advised the sellers on the deal. | N/A | Austria | Here |
24-Mar | BPV Huegel; Dechert; Dorda | Dechert and BPV Huegel advised Valneva Austria GmbH on debt financing it received from the US-based Deerfield and OrbiMed healthcare funds. Dorda advised the lenders. | USD85million | Austria | Here |
27-Mar | Dorda; Reidlinger Schatzmann | Dorda advised Warburg-HIHInvest Real Estate on the sale of a multi-story office building in the Summering part of Vienna to a real estate fund managed by Luxembourg-based Blue Colibri Capital. Reidlinger Schatzmann advised the buyers. | N/A | Austria | Here |
3-Apr | Fellner Wratzfeld & Partner | Fellner Wratzfeld & Partner advised VTB Bank Europe on financing provided to an unidentified buyer for its acquisition of 50% of SEMA Vermoegensverwaltung GmbH, the Austrian holding company of the Planquadr.at development and real estate portfolio group. | N/A | Austria | Here |
7-Apr | Dorda; Herbst Kinsky | Dorda advised joint global coordinators UBS and HSBC on the EUR 1.65 billion capital increase of Austria's AMS AG. | EUR1.65billion | Austria | Here |
7-Apr | Dorda | Dorda advised Lernsieg Mobile Media GmbH on data protection issues related to the relaunch of its Lernsieg app, which allows students to evaluate their schools and teachers. | N/A | Austria | Here |
9-Apr | Weber & Co.; White & Case | Weber & Co. advised OMV AG on the issuance of multi-tranche corporate bonds. White & Case Frankfurt advised joint lead managers Barclays Bank Ireland PLC, Credit Agricole Corporate and Investment Bank, MUFG Securities, Societe Generale, and UniCredit Bank Austria AG. | EUR1.75billion | Austria | Here |
14-Apr | Allen & Overy; Dorda; Eisenberger & Herzog | Dorda advised Greiner AG on the takeover of Eurofoam GmbH from Recticel. The Brussels office of Allen & Overy and Eisenberger & Herzog advised Recticel on the deal. | N/A | Austria | Here |
15-Apr | Wolf Theiss | Wolf Theiss advised Japan's Takeda Pharmaceuticals on its acquisition of Plasmaspendedienst GmbH. | N/A | Austria | Here |
15-Apr | Cerha Hempel | Cerha Hempel advised Philip Morris Austria GmbH on the launch of a new tobacco product in Austria. | N/A | Austria | Here |
15-Apr | Dorda | Dorda successfully represented Willhaben in a dispute against AutoScout24 AS involving the Austrian Unfair Competition Act. | N/A | Austria | Here |
15-Apr | Cerha Hempel | Cerha Hempel advised Philip Morris Austria on the launch of a new tobacco product in Austria. | N/A | Austria | Here |
15-Apr | Dorda | Dorda successfully represented Willhaben in a dispute with AutoScout24 AS. | N/A | Austria | Here |
15-Apr | Wolf Theiss | Wolf Theiss advised Japan's Takeda Pharmaceuticals on its acquisition of Plasmaspendedienst GmbH. | N/A | Austria | Here |
17-Apr | Allen & Overy; Binder Groesswang; Cerha Hempel; Eisenberger & Herzog; Schoenherr | Cerha Hempel and Schoenherr advised OMV on the acquisition of a 39% stake in Borealis AG from Mubadala for USD 4.68 billion. Allen & Overy, Eisenberger & Herzog, and Binder Groesswang advised Mubadala on the transaction. | USD4.68billion | Austria | Here |
22-Apr | Baker Mckenzie | Baker McKenzie advised McDonald's on the implementation of short-time work for all of its restaurants in Austria due to the Coronavirus pandemic. | N/A | Austria | Here |
27-Apr | Binder Groesswang | Binder Groesswang advised Lenzing AG and Palmers Textil AG on the establishment of a joint venture to produce protective masks in Austria. | N/A | Austria | Here |
29-Apr | Binder Groesswang | Binder Groesswang helped Austrian Post with the launch of its new bank - Bank99. | N/A | Austria | Here |
30-Apr | DLA Piper | DLA Piper Austria advised FFF Real Estate, a subsidiary of FFF Fund I SCSp SICAV-RAIF, on financing provided to an unnamed residential real estate developer for the acquisition and development of an unspecified residential project in Luxembourg. | N/A | Austria | Here |
30-Apr | Cerha Hempel; Schoenherr | Cerha Hempel advised the shareholders of Austrian electric motor manufacturer ELIN Motoren GmbH on the sale of a 70% stake in the company to the Voith technology group. Schoenherr advised the buyers. | N/A | Austria | |
4-May | Binder Groesswang; Freimuller Obereder Pilz | Binder Groesswang and Freimuller Obereder Pilz advised on Sapphire Ventures' participation in Adverity's EUR 23 million Series C financing round. Adverity was advised by Freimuller Obereder Pilz. | EUR23million | Austria | Here |
7-May | PHH Rechtsanwalte | PHH helped GR Real acquire the historic Art Nouveau apartment building in Linz. | N/A | Austria | Here |
8-May | Cerha Hempel; Fellner Wratzfeld & Partner; Schoenherr | Schoenherr advised Voith and Fellner Wratzfeld & Partner advised PCS on their acquisition of 59% of the shares of Traktionssysteme Austria GmbH. Cerha Hempel advised the selling shareholders on the deal. | N/A | Austria | Here |
8-May | Wolf Theiss | Wolf Theiss assisted Swiss investment foundation AFIAA on the sale of a six-property office and retail property portfolio in Salzburg to German property developer RMI. | N/A | Austria | Here |
22-May | BPV Huegel; Lenz & Staehelin; Simpson Thacher & Bartlett | BPV Huegel, working alongside Switzerland's Lenz & Staehelin law firm, advised Raiffeisen Informatik on the sale of shares in SoftwareONE Holding AG via an over-night accelerated book-building process. Credit Suisse AG, J.P. Morgan Securities plc, UBS AG, and KKR Capital Markets Partners LLP acted as joint book-runners for the placement. Simpson Thacher & Bartlett advised KKR on the deal. | CHF350million | Austria | Here |
22-May | Dorda; Eisenberger & Herzog; GSK Stockmann; Hogan Lovells | Dorda and Hogan Lovells advised ARE Austrian Real Estate on a joint project with UBM Development involving the development of part of the Aspanggrunde in Vienna's 3rd district and an area in Munich. UBM was advised by Eisenberger & Herzog and GSK Stockmann. | N/A | Austria | Here |
22-May | Schoenherr; Wolf Theiss | Schoenherr advised Invester United Benefits on the sale of the Wohngarten residential construction project in Vienna to ZBI Zentral Boden Immobilien Gruppe. Wolf Theiss advised the buyers on the deal. | N/A | Austria | Here |
27-May | Deloitte Legal; Lumsden and Partners | Deloitte Legal advised Magenta Telekom on structuring its cooperation with the City of Vienna regarding broadband coverage. Lumsden and Partners advised the City of Vienna on the deal. | EUR1billion | Austria | Here |
28-May | Brandl & Talos; Covington & Burling; Herbst Kinsky; Mcdermott Will & Emery; Wilson Sonsini Goodrich & Rosati; Wolf Theiss | Wolf Theiss and Covington & Burling advised MSD on its acquisition of Austrian biotech company Themis Bioscience. Brandl & Talos and Wilson Sonsini Goodrich & Rosati advised the selling shareholders on the deal, with McDermott Will & Emery and Herbst Kinsky advising Themis Bioscience. | N/A | Austria | Here |
9-Jun | Allen & Overy; BPV Huegel; Dorda; Rittershaus; Siwa Rechtsanwalte Szinger & Partner | BPV Huegel, working with SIWE Rechtsanwalte Sinzger & Partner, advised Dogado GmbH - a subsidiary of European Directories - on its acquisition of Austrian hosting provider Easyname GmbH. Dorda and Rittershaus advised the seller, Easyname's Founder and Managing Director Florian Schicker, and Allen & Overy's Frankfurt office advised European Directories. | N/A | Austria | Here |
9-Jun | Taylor Wessing; Wolf Theiss | Taylor Wessing advised the Korber Group and subsidiary Werum IT Solutions GmbH on their acquisition of the operations of Exputec GmbH and Exputec Kft. Wolf Theiss advised Exputec on the deal. | N/A | Austria | Here |
10-Jun | Cerha Hempel; Preslmayr | Cerha Hempel, working alongside German law firm Menold Benzler, advised Alfred Ritter GmbH & Co KG on its acquisition of a production facility belonging to Mars Austria OG in the Austrian village of Breitenbrunn. Preslmayr advised Mars. | N/A | Austria | Here |
11-Jun | Weber & Co.; Wolf Theiss | Weber & Co advised Wienerberger AG, a Vienna-based supplier of building materials and infrastructure solutions, on its issuance of EUR 400 million of 2.750% 2020-2025 Bonds. Wolf Theiss advised joint lead managers BNP Paribas, Raiffeisen Bank International AG, and UniCredit on the issuance. | EUR400million | Austria | Here |
11-Jun | Fellner Wratzfeld & Partner | Fellner Wratzfeld & Partners supported the biodiversity project known as "Mielo" and donated a large amount of the honey produced through the project to the parish of St. Stephen's Cathedral in Vienna. | N/A | Austria | Here |
18-Jun | Cerha Hempel; Wolf Theiss | Wolf Theiss advised Euronext Amsterdam-listed Royal DSM on its acquisition of the Erber Group. Cerha Hempel advised San Pacific Investment and San Venture Biotech, as well as their sole shareholder Erich Erber, on the sale of Erber to Royal DSM. | EUR1.06billion | Austria | Here |
24-Jun | Weber & Co.; White & Case | Weber & Co advised OMV AG, the international integrated oil and gas company headquartered in Vienna, on the issuance of two tranches of corporate bonds. White & Case's Frankfurt office advised joint lead managers Citigroup Global Markets Europe AG, Commerzbank Aktiengesellschaft, Erste Group Bank AG, Landesbank Baden-Wuerttemberg, Mizuho Securities Europe GmbH, and Raiffeisen Bank International AG. | EUR1.5billion | Austria | Here |
26-Jun | Dorda | Dorda advised Eastern Property Holdings on the acquisition of an office building in Vienna. | N/A | Austria | Here |
26-Jun | BPV Huegel | BPV Huegel helped Austrian low-cost airline Level Europe GmbH initiate and implement judicial insolvency proceedings at the Regional Court of Korneuburg. | N/A | Austria | Here |
30-Jun | Schoenherr | Schoenherr advised a club of lenders led by Erste Group and including Raiffeisen Bank International, UniCredit Bank Austria, BAWAG, and Oberbank on a EUR 300 million financing for Austrian Airlines. | EUR300million | Austria | Here |
30-Jun | Eisenberger & Herzog | Eisenberger & Herzog helped OBB-Technische Services GmbH, LTE Logistik Transport-GmbH, and ELL Austria GmbH set up a joint venture to establish and operate a service base for locomotives. | N/A | Austria | Here |
1-Jul | Milbank; Morgan Lewis & Bockius; Paul, Weiss, Rifkind, Wharton & Garrison; Schoenherr | Schoenherr, Milbank, and Paul Weiss advised NuCom Group, a joint venture of ProSiebenSat.1 and General Atlantic, on its acquisition of The Meet Group, Inc. Morgan Lewis advised the sellers. | EUR451million | Austria | |
1-Jul | Schoenherr; Schrebaum Seebacher | Schonherr advised Union Investment on the acquisition of a residential complex in Graz from the Immola Group. Scherbaum Seebacher advised the Immola Group on the deal. | N/A | Austria | Here |
2-Jul | BPV Huegel; Kung Rechtsanwalte & Notare; Lenz & Staehelin; Simpson Thacher & Bartlett | BPV Huegel advised Raiffeisen Informatik on the sale of shares in SoftwareONE Holding by KKR, Raiffeisen Informatik, and the heirs of Patrick Winterin, via an accelerated book-building process. Lenz & Staehelin acted as Swiss counsel for the sellers, KKR was advised by Simpson Thacher & Bartlett, and the heirs of Patrick Winter were advised by Switzerland's Kung Rechtsanwalte & Notare firm. | CHF380million | Austria | Here |
2-Jul | Herbst Kinsky | Herbst Kinsky advised Viennese start-up GoStudent GmbH on its EUR 8.3 million series A financing round, which was led by VC fund Left Lane Capital. | EUR8.3million | Austria | Here |
3-Jul | 42Law; Cerha Hempel; Deloitte Legal | Cerha Hempel, working alongside Deloitte Legal in Germany, advised Germany's GBTEC Software + Consulting AG on the acquisition of all shares in Avedos, a Vienna-based GRC software specialist, through direct and indirect share purchases and by means of a contribution by Samuel Brandstatter - the founder, managing director and shareholder of Avedos. 42law advised Brandstatter on the deal. | N/A | Austria | Here |
13-Jul | Binder Groesswang; Clifford Chance | Binder Groesswang and Clifford Chance Frankfurt advised BNP Paribas' Arval subsidiary on the acquisition of UniCredit Leasing Fuhrparkmanagement GmbH and a long-term cooperation agreement with UniCredit Bank Austria. | N/A | Austria | Here |
14-Jul | Schoenherr | Schoenherr successfully represented TIWAG-Tiroler Wasserkraft AG before Austria's Administrative Court in the last challenge to the implementation of the Kuhtai Storage Power Plant project. | N/A | Austria | Here |
15-Jul | Eisenberger & Herzog; Peters, Schonberger & Partner | Eisenberger & Herzog, working alongside Germany's Peters, Schonberger & Partner, advised Vetter Pharma on its acquisition of a clinical production facility in Rankweil, Austria. | N/A | Austria | Here |
16-Jul | Eisenberger & Herzog | Eisenberger & Herzog advised the Switzerland's Brisen Group on its entrance into an operating agreement with the Mandarin Oriental hotel chain. | EUR100million | Austria | Here |
17-Jul | BPV Huegel; Linklaters; Weber & Co. | BPV Huegel advised Immofinanz on a combined share placement and the first-to-market issue of subordinated mandatory convertible notes. Linklaters and Weber & Co. advised bookrunners J.P. Morgan Securities plc, Sole Global Coordinator, and Erste Group Bank AG and Raiffeisen Centrobank AG. | N/A | Austria | Here |
20-Jul | Eisenberger & Herzog | Eisenberger & Herzog helped Austrian Airlines on its receipt of State aid amounting to EUR 150 million from the Republic of Austria. | EUR150million | Austria | Here |
22-Jul | Freshfields; Schoenherr | Freshfields Bruckhaus Deringer advised an international banking consortium consisting of HSBC Bank plc, JP Morgan Securities plc, and Raiffeisen Bank International AG on Uniqua Insurance Group AG's successful issuance of two bonds worth a total of EUR 800 million. Schoenherr advised Uniqua on the deal. | EUR800million | Austria | Here |
22-Jul | DLA Piper | DLA Piper advised Austria's Kurant GmbH on the Europe-wide roll-out of its Bitcoin vending machines. | N/A | Austria | Here |
24-Jul | Binder Grosswang; BPV Huegel; Herbert Smith Freehills | BPV Huegel worked with the Frankfurt office of Herbert Smith Freehills in advising the Heidelpay Group, a German technology company for international payments, on the acquisition of the Paysafe Group's Pay Later business. Binder Groesswang advised the Paysafe group. | N/A | Austria | Here |
30-Jul | Themmer Toth & Partner; Weber & Co. | Weber & Co. advised Central European University on its July 27, 2020 agreement with the Vienna Business Agency to use the Otto Wagner site in Vienna as the university's new site. Themmer, Toth & Partner advised the Vienna Business Agency. | N/A | Austria | Here |
31-Jul | Schoenherr | Schoenherr assisted Auer-Blaschke GmbH & Co KG with the registration of its new AUER brand design as a model brand at the Austrian Patent Office. | N/A | Austria | Here |
5-Aug | Eisenberger & Herzog; Schnittker Moellmann Partners | Eisenberger & Herzog advised Samsung Catalyst Fund, a venture capital fund of Samsung Electronics Co., Ltd, on an undisclosed investment in the Speedinvest 3 fund, which was advised by Berlin-based Schnittker Mollmann Partners. | N/A | Austria | Here |
7-Aug | Herbst Kinsky | Herbst Kinsky advised Byrd technologies GmbH on a EUR 5 million Series A financing round. | EUR5million | Austria | Here |
10-Aug | Freshfields; Linklaters; Wolf Theiss | Wolf Theiss and Linklaters advised Raiffeisen Bank International AG on the issuance of EUR 500 million worth of additional Tier 1 capital. Freshfields Bruckhaus Deringer advised joint lead managers Barclays Bank plc, Goldman Sachs International, J.P. Morgan Securities plc, Raiffeisen Bank International AG, and UBS Europe SE. | EUR500million | Austria | Here |
11-Aug | Brandl & Talos | Brandl & Talos advised BTOV's Industrial Technologies Fund on its participation in ToolSense's financing round that also included AWS Grunderfonds, Segnalita Ventures, Martin Global AG, and Dr. Georg Hoblik GmbH. | EUR3million | Austria | Here |
11-Aug | Fellner Wratzfeld & Partner | Fellner Wratzfeld & Partner advised a consortium of UniCredit Bank Austria, BAWAG P.S.K, Commerzbank, Raiffeisenlandesbank Oberoesterreich, and HYPO Vorarlberg on the reorganization proceedings of the Huber Group, an Austrian lingerie manufacturer. | N/A | Austria | Here |
17-Aug | Linklaters; Schoenherr | Schoenherr advised HETA Resolution AG on the sale of Julia Portfolio Solutions S.p.A., an Italy-based company engaged in the non-performing loan sector, to Bain Capital Credit, LP. Linklaters advised the buyers. | N/A | Austria | |
24-Aug | Baker Mckenzie; Freimuller Obereder Pilz | Baker McKenzie advised Amplifier Game Invest on the acquisition of games developer Rare Earth Games. The Freimueller, Obereder, Pilz firm advised Rare Earth Games founders Michael Borras, Peter Ehardt, and Helmut Hutterer. | EUR300000 | Austria | Here |
30-Aug | Allen & Overy; Cerha Hempel; Eisenberger & Herzog; Schoenherr | Cerha Hempel advised EnBW Trust e.V. and EnBW Energie Baden-Wurttemberg AG on the sale of a 28.35% stake in EVN AG that was held in trust for EnBW by the EnBW Trust. Allen & Overy and Eisenberger & Herzog advised the buyers. EVN was advised by Schoenherr. | EUR1billion | Austria | |
31-Aug | Rautner Attorneys at Law | Rautner Rechtsanwalte advised Windkraft Simonsfeld on a EUR 63 million financing deal with the European Investment Bank and Erste Bank. | EUR63million | Austria | Here |
2-Sep | Herbst Kinsky | Herbst Kinsky advised Presono GmbH on a media-for-equity deal with Seven Ventures Austria. | N/A | Austria | Here |
3-Sep | Gassauer-Fleissner; PHH Rechtsanwalte | PHH advised Bondi Consult on the sale of the "service hub" part of the TwentyOne commercial project in Vienna's Floridsdorf district to InterXion. Gassauer-Fleissner Rechtsanwalte advised InterXion on the deal. | N/A | Austria | Here |
4-Sep | EY Law; Schoenherr | Schoenherr advised Art-Invest Real Estate on the acquisition of the Q11 - Leben am Fluss residential property in Sankt Polten, Lower Austria. EY Law advised the seller. | N/A | Austria | |
7-Sep | Weber & Co.; White & Case; Wolf Theiss | White & Case and Wolf Theiss advised joint lead managers Barclays, MUFG, UniCredit Bank Austria, BNP Paribas, Credit Agricole CIB, J.P. Morgan, Societe Generale Corporate & Investment Banking, Bayern LB, DZ Bank AG, Helaba and SMBC Nikko on OMV Aktiengesellschaft's EUR 1.25 billion hybrid bonds issue. Weber & Co advised the issuer on the deal. | EUR1.25billion | Austria | Here |
15-Sep | Binder Groesswang; Bird & Bird | Binder Groesswang and Bird & Bird advised Blockpit on its acquisition of 21 Consulting. | N/A | Austria | Here |
21-Sep | Binder Groesswang | Binder Groesswang advised Austrian cryptocurrency service provider SmartBytes GmbH, operating as Coinpanion, on a pre-seed financing round. | N/A | Austria | Here |
22-Sep | Dorda; Eisenberger & Herzog | Dorda advised Patrizia AG on the acquisition of the Aira Tower residential project in Graz from Aira Development Group. Eisenberger & Herzog advised the Aira Development Group on the sale. | N/A | Austria | Here |
2-Oct | Schoenherr | Schoenherr advised Austrian fintech Bitpanda on a European Series A financing round that was led by Valar Ventures. Taylor Wessing advised Valar Ventures. | USD52million | Austria | Here |
6-Oct | Cerha Hempel; Schoenherr | Cerha Hempel advised OMV on the sale of its 51% stake in Gas Connect Austria GmbH to Verbund AG. Schoenherr advised Verbund on the sale. | EUR271million | Austria | Here |
9-Oct | Delphi; Schoenherr; SCWP Schindhelm | Schoenherr and Sweden's Delphi law firm advised AddLife on its acquisition of all shares in the DACH Medical Group Holding AG. The unidentified sellers were advised by SCWP Schindhelm. | N/A | Austria | Here |
12-Oct | De Breij Boon Evers; Fasken Martineau Dumoulin; K.Treppides & Co; McMillan; Schoenherr; Stibbe | Schoenherr, McMillan, De Breij Boon Evers, and K.Treppides & Co advised Smart2Pay Global Services B.V. on its sale to the Nuvei Corporation. Stibbe and Fasken Martineau Dumoulin advised the buyer. | EUR221.57million | Austria | |
15-Oct | Binder Groesswang; Bird & Bird | Binder Groesswang, working alongside lead counsel Bird & Bird, advised European investment fund Cube Infrastructure Fund II on the acquisition of a majority stake in Switzerland's Heliot Group. | N/A | Austria | Here |
16-Oct | Binder Groesswang; Grama Schwaighofer Vondrak Rechtsanwalte | Binder Groesswang advised UBM Development on the sale of its housing project in Vienna's Nordbahnviertel district to the Buwog Group. Grama Schwaighofer Vondrak advised Buwog on the deal. | EUR50million | Austria | Here |
16-Oct | CMS | CMS Austria advised Oesterreichische Nationalbank on the Felix Austria project, which seeks to modernize the processing of bulk payment transactions in Austria. | N/A | Austria | Here |
16-Oct | Binder Groesswang; DLA Piper | Binder Groesswang advised Lafayette Mittelstand Capital on its acquisition of the elevator cable business from the Gebauer & Griller Group as part of a carve-out. DLA Piper advised Gebauer & Griller on the deal. | N/A | Austria | Here |
19-Oct | CMS | CMS advised Bechtle AG on its acquisition of Dataformers GmbH. | N/A | Austria | Here |
20-Oct | Ashurst; Bredin Prat; Dr. Beck & Partner; Taylor Wessing; Schoenherr | Schoenherr, Ashurst, and Dr. Beck & Partner advised Schlemmer GmbH on its acquisition by Delfingen Industry. S.A. Bredin Prat and Taylor Wessing advised the buyer. | N/A | Austria | |
22-Oct | Binder Groesswang; Garrigues; Willkie Farr & Gallagher; Wolf Theiss | Binder Groesswang and Willkie Farr & Gallagher have advised private equity investment company Ardian on the sale of Gantner Electronic Austria Holding GmbH to Salto Systems. Wolf Theiss and Garrigues advised Salto Systems. | N/A | Austria | Here |
23-Oct | BPV Huegel; Lenz & Staehelin | BPV Huegel and Lenz & Staehelin have advised Raiffeisen Informatik on the sale of the remaining shares in SoftwareONE Holding in an accelerated book-building process. | CHF111million | Austria | Here |
27-Oct | CMS | CMS advised green electricity provider eFriends on the sale of a 24% stake to RWA Raiffeisen Ware Austria. | N/A | Austria | Here |
28-Oct | Allen & Overy; Eisenberger & Herzog; Freshfields; Shearman & Sterling | Eisenberger & Herzog, Allen & Overy, and Shearman & Sterling advised SAP SE on iyd acquisition of Emarsys, a Viennese cloud-based provider of omnichannel customer loyalty platforms. Freshfields Bruckhaus Deringer advised Emarsys. | N/A | Austria | Here |
28-Oct | Fellner Wratzfeld & Partner | Fellner Wratzfeld & Partner advised Immobilien Holding on the sale of its shares in Arwag Holding to the Fund for Temporary Housing in Vienna. | N/A | Austria | Here |
29-Oct | Binder Groesswang; Brandl & Talos; Hengeler Mueller; Schif Hardin | Binder Groesswang, Schiff Hardin, and Hengeler Mueller advised California-based medical devices and life science instruments manufacturer Paramit Corporation on the acquisition of Austria's System Industrie Electronic GmbH and its German subsidiary, System Industrie Electronic Deutschland GmbH, from former majority shareholder System Industrie Holding AG (and its ultimate owner, the Filzmaier Private Foundation) and Aws Mittelstandsfonds, a former minority shareholder. Brandl & Talos advised the sellers on the transaction. | N/A | Austria | Here |
30-Oct | Act Legal (WMWP); Schoenherr | Schoenherr advised Austrian start-up Carbomed Medical Solutions on a EUR 3 million financing round led by AWS Gruenderfonds. Act Legal Austria WMWP advised AWS Gruenderfonds on the deal. | EUR3million | Austria | Here |
30-Oct | 42Law; Eisenberger & Herzog | Eisenberger & Herzog advised Markus Kummel, Oliver Jusinger, and Andreas Kossmeier, the founders of the Bergfex tourism platform, on the sale of a 60% stake to Russmedia Equity Partners. 42law advised Russmedia Equity Partners on the deal. | N/A | Austria | Here |
2-Nov | Cleary Gottlieb Steen & Hamilton, Hengeler Mueller; Linklaters; Milbank; Schoenherr | Schoenherr, Milbank, and Linklaters advised The Carlyle Group on its acquisition of Flender, a Germany-based specialist in mechanical and electrical drive technology, from Siemens. Cleary Gottlieb and Hengeler Mueller advised the buyer. | EUR2billion | Austria | |
2-Nov | Bahr; Brandl & Talos; Bruun & Hjejle; Cirio; Wikborg | Rein | Brandl & Talos advised Ring International Holding on its takeover of the Burger King franchise in Norway, Sweden, and Denmark from Umoe Restaurants. Norwegian law firm Bahr advised the seller on the deal. Wikborg | Rein in Norway, Cirio in Sweden, and Bruun & Hjejle in Denmark acted as local advisors to the buyer. | N/A | Austria | Here |
3-Nov | Cerha Hempel; Linklaters | Cerha Hempel advised Immofinanz on its successful placement of an unsubordinated, unsecured bonds issue worth EUR 500 million. Citigroup and J.P. Morgan Securities acted as joint global coordinators and joint bookrunners, while Credit Suisse, Deutsche Bank, Erste Group Bank, and HSBC served as joint bookrunners on the deal. Linklaters advised the underwriters. | EUR500million | Austria | Here |
3-Nov | Arnold Rechtsanwalte; Dorda | Dorda advised Ascott on an agreement for serviced residences in the Forum Donaustadt/Vienna Twentytwo development in Vienna with Signa Real Estate and Austria Real Estate. The aparthotel will be marketed under the Citadines Apart'hotel brand and is scheduled to open at the end of 2022. Arnold advised Signa and ARE on the deal. | N/A | Austria | Here |
4-Nov | Schoenherr | Schoenherr successfully represented Austrian AOP Orphan Pharmaceuticals AG in arbitration against Taiwan's PharmaEssentia Corporation. | N/A | Austria | Here |
4-Nov | Schoenherr; Wolf Theiss | Schoenherr and Wolf Theiss advised Innio Jenbacher GmbH & Co OG on the acquisition of ECI-Distribution GmbH and its service partner PowerUp GmbH. | N/A | Austria | |
5-Nov | Dorda | Dorda successfully defended Energy Hero in a case heard by the Austrian Supreme Court against an unspecified energy supplier. | N/A | Austria | Here |
6-Nov | CMS; KPMG Legal | CMS advised Plastic Omnium on establishing a joint venture with ElringKlinger. In addition, Plastic Omnium acquired ElringKlinger's_Austrian subsidiary, ElringKlinger_Fuelcell_Systems Austria. KPMG Law advised ElringKlinger. | EUR15million | Austria | Here |
11-Nov | Cerha Hempel; Linklaters | Cerha Hempel advised CA Immobilien Anlagen on its EUR 350 million placement of a fixed rate senior unsecured green bond. Linklaters advised joint global coordinators J.P. Morgan Securities plc and Morgan Stanley & Co International plc and joint bookrunners and joint sustainability structuring agents UniCredit Bank AG and Raiffeisen Bank International AG. | EUR350million | Austria | Here |
13-Nov | Binder Groesswang | Binder Groesswang advised the SeneCura Group on its acquisition of Austria's St. Veit/Glan therapy center. | N/A | Austria | Here |
17-Nov | Brandl & Talos; TBS Schmidt | Brandl & Talos advised AWS Grunderfonds on its EUR 1.8 million seed investment in Vienna-based real estate startup Rendity. TBS Schmidt reportedly advised Rendity on the deal. | EUR1.8million | Austria | Here |
23-Nov | Herbst Kinsky | Herbst Kinsky helped Austrian start-up Trality attract EUR 1.5 million in financing from a group of German investors including Blockrocket, VC Tokentus, FFG, and AWS. | EUR1.5million | Austria | Here |
23-Nov | Graf & Pitkowitz | Graf & Pitkowitz advised Germany's Cherry GmbH on the acquisition of Austria's Theobroma Systems Design and Consulting GmbH. | N/A | Austria | Here |
26-Nov | Herbst Kinsky | Herbst Kinsky advised investment company Round2Capital Partners GmbH & Co KG on its EUR 6.6 million financing round. | EUR6.6million | Austria | Here |
27-Nov | AGP Advokater; EY Law; Schoenherr | Schoenherr advised Christian Bamberger, SK Capital GmbH, Foxyflo GmbH, Christian Waldheim, and Martin Mrvka on the sale of 100% of Austrian communication-platform-as-a-service companies ATMS, SMS.AT, and WebSMS to Norwegian Link Mobility Holding ASA. AGP Advokater and EY Law advised Link Mobiliy on the transaction. | N/A | Austria | Here |
4-Dec | Dorda | Dorda successfully represented Italian investor Francesco Becchetti in enforcement proceedings against the assets of the Republic of Albania in Austria. | EUR25million | Austria | Here |
7-Dec | Lorenz & Strobl; Schoenherr | Schoenherr advised Gebauer & Griller Kabelwerke GmbH on its acquisition by Konstant Industriebeteiligung GmbH. Lorenz & Strobl advised the buyer. | N/A | Austria | |
9-Dec | Dorda | Dorda advised DLH Real Estate Austria on the sale of a 65,000-square-meter section of the Industrial Campus Vienna East to Deka Immobilien. | N/A | Austria | Here |
11-Dec | Dorda; PwC Legal | Dorda advised DLH Real Estate Austria on the acquisition of a 30,000-square-meter property in the Future Zone East industrial park from Vienna Airport Business Park and Airport Services VIE Immobilien. PwC Legal advised the sellers on the deal. | N/A | Austria | Here |
14-Dec | Clifford Chance; Linklaters; Schoenherr | Schoenherr and Clifford Chance advised Hypo Vorarlberg on the synthetic securitization of a EUR 330 million portfolio of loans to small and medium-sized enterprises, corporate borrowers, or certain private individuals, which was provided by the European Investment Fund and European Investment Bank. Linklaters advised the EIF and EIB on the deal. | EUR330million | Austria | Here |
14-Dec | CMS | CMS advised A1 Telekom Austria AG on the acquisition of Alcatel-Lucent Voice Business, the classic telephony business of technology service provider NTT Ltd. | N/A | Austria | Here |
14-Dec | Binder Groesswang; Schoenherr | Binder Groesswang advised OBB-Technische Services on the establishment of a joint venture with Voestalpine Stahl for the purpose of freight wagon production. Schoenherr advised the co-venturer on the deal. Gleiss Lutz reportedly acted as a local advisor in Germany to Voestalpine. | N/A | Austria | Here |
15-Dec | Cerha Hempel; Eisenberger & Herzog | Eisenberger & Herzog advised German real estate investment and asset manager Hamburg Trust on the acquisition of the newly constructed Siemensstrasse residential living project in Vienna from Eyemaxx Real Estate AG, advised by Cerha Hempel. | N/A | Austria | Here |
15-Dec | Herbst Kinsky | Herbst Kinsky advised Biogena Group Invest on the initial public offering of its shares and their listing on the Vienna Stock Exchange. | N/A | Austria | Here |
18-Dec | Binder Groesswang; Linklaters; Wolf Theiss | Binder Groesswang advised Lenzing AG on the successful issuance of a EUR 500 million hybrid bond. Linklaters and Wolf Theiss advised joint global coordinators BNP Paribas and Morgan Stanley and joint bookrunners BNP Paribas, Morgan Stanley, and UniCredit. | EUR500million | Austria | Here |
21-Dec | Eisenberger & Herzog; Oberhammer | Eisenberger & Herzog advised Krenhof AG on its merger with Pankl Racing Systems AG. Oberhammer advised Pankl Racing Systems on the merger. | N/A | Austria | Here |
22-Dec | CMS; Wolf Theiss | CMS has advised joint lead managers BofA Securities, BNP Paribas, Erste Group, Goldman Sachs International, JP Morgan, and UBS on Erste Group Bank AG's EUR 750 million issuance of undated fixed-to-fixed resettable notes. Wolf Theiss advised the issuer on the deal. | EUR750million | Austria | Here |
22-Dec | Cerha Hempel | Cerha Hempel helped Germany's COSI Hospitality Group enter the Austrian hotel and apartment market. | N/A | Austria | Here |
23-Dec | Clifford Chance; Hogan Lovells; Latham & Watkins | Cerha Hempel and Hogan Lovells advised OMV on the sale of its filling station business in Germany to Britain's EG Group. Latham & Watkins advised the EG Group on the deal. | EUR485million | Austria | Here |
23-Dec | Eisenberger & Herzog; Schoenherr | Schoenherr advised UBS Europe SE on the sale of its onshore wealth management business in Austria to LGT Bank AG. | N/A | Austria | Here |
24-Dec | Brandl & Talos; SMP | Brandl & Talos and SMP advised System Industrie Electronic Holding on the acquisition of a 70.1% stake in Elektromotorenwerk Grunhain. | N/A | Austria | Here |
28-Dec | Eisenberger & Herzog; Taylor Wessing | Eisenberger & Herzog advised Wien Energie GmbH on the acquisition of a 49% stake in Austria's Pongratzer Kogel, Herrenstein, and Zagersdorf wind farms from wind and solar farm operator Encavis AG. Taylor Wessing advised Encavis on the deal. | N/A | Austria | Here |
30-Dec | Buchberger Rechtsanwalts; Schoenherr | Schoenherr advised Bilfinger Maschinenbau GmbH & Co KG on thesale of its mechanical and apparatus engineering business to ISW Heavy Components GmbH. Buchberger Rechtsanwalts advised the buyer. | N/A | Austria | |
1-Aug | Kovacevic Prpic Simeunovic; Roedl & Partner; Waitz Rechtsanwalte | KPS, working with Roedl & Partner and Mazars Croatia, advised Tyssenkrupp on the Croatian aspects of a multijurisdictional corporate restructuring project, in particular on cross-border upstream merger of its Croatian subsidiary, along with four other EU-based entities, into a newly established EU-based holding company. Waitz Rechtsanwalte advised on Austrian law. | N/A | Austria, Croatia; Czech Republic; Hungary; Poland; Romania | |
1-Sep | Akin Gump; McCann FitzGerald; Schoenherr; Watson Farley & Williams | Schoenherr, Akin Gump, and McCann FitzGerald advised Endava plc, a UK-based provider of information technology services, on the acquisition of Comtrade Digital Services Limited, an Ireland-based provider of strategic software engineering services and solutions, from Serbia's Comtrade Group B.V. Watson Farley & Williams advised the sellers. | EUR60million | Austria; Bosnia and Herzegovina; Serbia; Slovenia | |
15-Jun | Schoenherr | Schoenherr, acting as leader of a consortium of European law firms, conducted what it describes as "a comprehensive study on the regulatory and administrative requirements for entry and trade on the gas wholesale market in the EU for the European Commission, Directorate General Energy." | N/A | Austria; Bulgaria | Here |
11-Mar | Bopa Bojanovic Partners; Cerha Hempel; K&L Gates; Kavcic Bracun & Partners; Madirazza & Partners; Prelevic Law Firm | Cerha Hempel and K&L Gates advised the EBRD on the conversion of its indirect participation in listed Addiko Bank AG into a direct participation. Freshfields Austria served as local counsel to Advent International Corporation. Bopa Bojanovic Partners in Serbia, Kavcic Bracun & Partners in Slovenia, Madirazza & Partners in Croatia, and Prelevic Law firm of the Adriala network advised the EBRD in the CSEE region. | EUR10.61billion | Austria; Croatia; Montenegro; Serbia; Slovenia | Here |
11-May | Binder Groesswang; Havel & Partners; Jandura a Partneri | Binder Groesswang and Havel & Partners advised BEXity and its holding company, Mutares SE & Co. KGaA, on the management buy-out of Czech subsidiary European Contract Logistics. The buyer, EC Logistics CEO Roman Goerojo, was advised by Jandura a Partneri. | N/A | Austria; Czech Republic | Here |
24-Jul | Mares & Partners; Schoenherr | Schoenherr advised IB Interbilanz Wirtschaftsprufungs GmbH & Co. KG on the sale of the Czech Republic's Grant Thornton Audit s.r.o. and Grant Thornton Tax and Accounting s.r.o. to Grant Thornton Advisory s.r.o. Mares & Partners advised the buyer. | N/A | Austria; Czech Republic | |
18-Nov | Baker Mckenzie; Clifford Chance; Lenz & Staehelin | Clifford Chance and Switzerland's Lenz & Staehelin advised the KKCG AG investment company and the Sazka Group on the EUR 500 million investment into Sazka by funds managed by affiliates of Apollo Global Management. Baker McKenzie advised Apollo. | EUR500million | Austria; Czech Republic | Here |
27-Feb | BonelliErede; Gianni Origoni Grippo Cappelli; Ludovici Piccone And Partners; Schoenherr | Schoenherr, in cooperation with BonelliErede, advised Covivio on its EUR 573 million acquisition of eight luxury hotels in Europe from alternative investment firm Varde Partners. Varde was reportedly advised by Italian firms Gianni Origoni Grippo Cappelli and Partners and Ludovici Piccone and Partners. | EUR573million | Austria; Czech Republic; Poland | Here |
11-Mar | Eisenberger & Herzog; Noerr | Noerr and Eisenberger & Herzog advised Austrian packaging company Coveris on its acquisition of Plasztik-Tranzit Kft, a producer of flexible packaging solutions for the food industry. The unidentified sellers were advised by solo practitioner Tamas Reisz. | N/A | Austria; Hungary | Here |
30-Sep | Dentons | Dentons helped Austrian insurance group UNIQA and CherryHUB, its Hungarian InsurTech subsidiary, enter the German market. | N/A | Austria; Hungary | Here |
7-Dec | Allen & Overy; NautaDutilh; Paksoy; RTPR; Wolf Theiss | Allen & Overy and RTPR advised Dutch life insurance, pension, and asset management company Aegon on the EUR 830 million sale of its operations in Romania, Hungary, Poland, and Turkey to the Vienna Insurance Group. Wolf Theiss, Paksoy, and NautaDutilh advised the Vienna Insurance Group on the deal. | EUR830million | Austria; Hungary; Poland; Romania; Turkey | Here |
15-Oct | CMS; Wolf Theiss | CMS advised Green Source GmbH and its Solar Partners subsidiary on financing provided by Kommunalkredit Austria for the construction of power plants in Hungary. Wolf Theiss advised Kommunalkredit Austria. | EUR66million | Austria; Hungary; Slovakia | Here |
9-Sep | CMS; Schoenherr | Schoenherr advised Twisto Finco PL SP z.o.o. on financing by new investors Orbit Capital SICAV, a.s. and Growth Finance s.r.o. CMS advised Orbit Capital. | EUR4.1million | Austria; Poland | |
6-Feb | Dentons; Kirkland & Ellis; Noerr | Dentons and Kirkland & Ellis represented GIC, Singapore's sovereign wealth fund, on the acquisition of the Maximus logistics real estate portfolio from funds managed by Apollo Global Management, a US-based private equity firm. Noerr advised the sellers on the transaction. | EUR950million | Austria; Poland; Slovakia | Here |
21-Oct | Clifford Chance; Popovici Nitu Stoica & Asociatii | PNSA advised beneficiary CE Oltenia in arbitral proceedings under ICC Rules initiated by a general contractor concerning a public procurement contract for the design, delivery, construction, assembly, and commissioning of a joint plant for flue gas desulphurisation in Romania. Clifford Chance advised the claimants. | N/A | Austria; Romania | |
29-Oct | Alrud | Alrud helped OMV AG and Borealis AG obtain antitrust and foreign investment clearances from FAS Russia for OMV's acquision of a 75% stake in Borealis. | USD4.68billion | Austria; Russia | |
28-Dec | CMS; Tomic Sindjelic Groza | CMS advised the UK's Poseidon Group and Belgium's Mitiska Reim on the divestment of their entire portfolio of retail parks in Serbia to Austria's Immofinanz AG. Tomic Sindjelic Groza advised Immofinanz on the deal. | N/A | Austria; Serbia | Here |
26-Jun | Cerha Hempel; Schoenherr | Cerha Hempel advised MK Group Global Limited on the acquisition of a loan portfolio from Heta Asset Resolution AG and the acquisition of the direct and indirect shareholdings of HETA in three Slovenian wind-down entities that manage receivables from non-performing loans granted by the former Hypo Alpe-Adria-Bank International AG and its subsidiaries to customers in Slovenia. Schoenherr advised the Republic of Austria as the owner of HETA. | N/A | Austria; Slovenia | Here |
5-Aug | Schoenherr; Wolf Theiss | Schoenherr advised S&T AG on its acquisition of Iskratel, d. o. o. Wolf Theiss advised the seller. | EUR38million | Austria; Slovenia | |
9-Oct | Eisenberger & Herzog; Milbank; Rojs, Peljhan, Prelesnik & Partners; Schoenherr | Eisenberger & Herzog, Milbank, and Rojs, Peljhan, Prelesnik & Partners advised the Sartorius Group on its acquisition of BIA Separations and its merger into its Sartorius Stedim Biotech subgroup. Schoenherr advised the unidentified majority shareholder of BIA Separations on the sale. | EUR360million | Austria; Slovenia | Here |
16-Nov | DLA Piper; Kirm Perpar | DLA Piper and Kirm Perpar successfully represented the Slovenian municipality of Kranjska Gora in an arbitration proceeding adjudicated at the Vienna International Arbitration Center against WTE Wassertechnik GmbH, a German supplier for municipal and industrial water management. | N/A | Austria; Slovenia | Here |
29-Jan | Schoenherr | Schoenherr advised TTTech Auto AG on its acquisition of 51% stake in Turkish automotive driver assistance software company Red Pine Software Inc. from Cem Sezer. Solo practitioner Merve Isgoren advised the seller. | N/A | Austria; Turkey | |
17-Jan | Sorainen | Sorainen advised Data Delivery LLC, a Belarus-based developer of the RocketData.io platform for managing business reputation and online data, on implementing share options for employees. | N/A | Belarus | Here |
13-Feb | Aleinikov & Partners | Aleinikov & Partners is representing Blitz Team in a dispute with Wargaming, developer of the game World of Tanks. | USD1.69million | Belarus | Here |
13-Feb | Aleinikov & Partners | Aleinikov & Partners advised Playrix on an unspecified investment in Belarusian studio Vizor Games. | N/A | Belarus | Here |
27-Feb | Revera; SBH | SBH advised Zubr Capital on the investment by its Zubr Capital Fund I in the Myfin Group, an IT platform for banking products. Revera advised Myfin Group on the transaction. | N/A | Belarus | Here |
1-May | Arzinger | Arzinger Law Offices advised Belarusian Railway regarding loan and account pledge agreements with the Export-Import Bank of China. | EUR66.7million | Belarus | |
4-May | EPAP; Sorainen | Sorainen advised DEG on the acquisition of a stake in Belgips, a Belarusian manufacturer of gypsum-based building materials. Belgips was advised by Egorov Puginsky Afanasiev & Partners. | N/A | Belarus | Here |
26-May | Sorainen | Sorainen successfully represented Belomo, a Belarusian enterprise specializing in optomechanical and optoelectronic equipment, in arbitration before the International Court of Arbitration of the International Chamber of Commerce. | N/A | Belarus | Here |
3-Jun | BNT Attorneys; Sorainen | Sorainen advised ERGO Group on the sale of its Belarusian non-life subsidiary, ERGO Insurance Company, to the Euroins Insurance Group. BNT advised the Euronis Insurance Group. | N/A | Belarus | Here |
1-Jul | Arzinger | Arzinger Law Offices advised Belarusbank on a loan from UBS Switzerland AG. | EUR89million | Belarus | |
1-Jul | Arzinger | Arzinger Law Offices advised Holding Belorusskie Oboi during negotiations with Austrian company Andritz on the terms of an investment project involving the re-equipment of the Dobrush Paper Factory. | EUR36million | Belarus | |
16-Jul | Aleinikov & Partners | Aleinikov & Partners has advised StringersHub on investment into the company by a group of angel investors and venture capital firms Insta Ventures and Starta Ventures. | USD500000 | Belarus | Here |
20-Jul | Arzinger | Arzinger Law Offices represented Azeraluminium in an antidumping investigation concerning imports to the Eurasian Economic Union of aluminium tape produced in Azerbaijan and China. | USD3.5million | Belarus | |
7-Oct | Sorainen | Sorainen advised Australia's Aristocrat Digital gambling machine manufacturer on an undisclosed investment in Belarusian game development studio Neskin Games. | N/A | Belarus | Here |
26-Oct | Sorainen | Sorainen helped the Turkey Wealth Fund obtain approval from the Ministry of Antimonopoly Regulation and Trade of the Republic of Belarus for its acquisition of control over Belarusian telecommunications network CJSC. | N/A | Belarus | Here |
1-Dec | Arzinger | Arzinger Law Offices advised the Ministry of Natural Resources and Environment of the Republic of Belarus on matters related to an international technical assistance project involving the development of wind energetics in the Republic of Belarus. | N/A | Belarus | |
1-Nov | BDV Legal; Borovtsov & Salei | Borovtsov & Salei and BDV Legal advised the Croatian Bank for Reconstruction and Development on funding of Be Cloud within a Buyer Credit Facility Agreement aimed at financing an export contract with Ericsson Nikola Tesla d.d. invoving the supply of equipment and software for the creation of a single LTE cellular mobile telecom network in Belarus. | EUR15million | Belarus; Croatia | |
7-Apr | Sorainen | Sorainen advised the Kaamos Group, its Estonian subsidiary Kamos Timber, and its Belarusian subsidiary, Mozyr Sawmill, on a EUR 15 million loan it received from the EBRD for the construction of a new sawmill in Belarus. | EUR15million | Belarus; Estonia | Here |
3-Dec | Baker Mckenzie; Cobalt; Njord | Cobalt and Baker McKenzie advised Flugger on its acquisition of 70% of the shares in the Eskaro Group, advised by Njord. | EUR8.4million | Belarus; Estonia; Latvia | Here |
7-Aug | Drakopoulos; Rosenfeld Farmer | Drakopoulos and Rosenfeld Farmer represented Suraleb in litigation against Minsk Tractor Works involving the enforcement of a UNCITRAL arbitral award. | EUR3million | Belarus; Romania | |
1-Jun | Arzinger | Arzinger Law Offices advised Belarusbank and Eximbank on a loan agreement related to financing and refinancing settlements of Belarusbank's corporate clients under trade contracts. | EUR30million | Belarus; Russia | |
1-Sep | Borovtsov & Salei; Ê Ê Ê Ê Ê Ê Ê Ê Ê Ê Ê Ê Ê Morgan Lewis & Bockius | Borovtsov & Salei and Morgan Lewis advised Russia's VTB Bank Public Stock Company on the execution of a Master Agreement on Derivatives and Swaps with Belagroprombank. | N/A | Belarus; Russia | |
24-Nov | Aksu Caliskan Beygo Attorney Partnership; Clifford Chance; Durukan+Partners; Herguner Bilgen Ozeke; Kabine Law Firm; Kinstellar; Milbank, Tweed, Hadley & Mccloy; Skadden, Arps, Slate, Meagher & Flom; Stibbe; Sullivan & Cromwell; White & Case | Istanbul's Durukan+Partners and Skadden Arps advised LetterOne on theÊ restructuring of Turkcell's shareholding structure. Milbank and Turkey's Aksu Caliskan Beygo Attorney Partnership advised the Turkey Wealth Fund and Ziraat Bank, Sullivan & Cromwell and Herguner Bilgen Ozeke advised Telia Finland, and White & Case and the Kabine Law Firm advised Cukurova on the deal. Clifford Chance advised Citibank on English law. Stibbe London B.V. advised IMTIS on Dutch law. Kinstellar advised the Turkish Wealth Fund on Ukrainian law. | USD2.38billion | Belarus; Turkey; Ukraine | Here |
28-Jul | Ilyashev & Partners | Acting on behalf of Challenge Shipping Ltd., the Odesa office of Ilyashev & Partners secured the acceptance by Ukraine's State Ecological Inspection of a British protection and indemnity club's letter of undertaking as a sufficient security for a maritime claim. | UAH13.5million | Belarus; Ukraine | Here |
21-Jan | Baros Bicakcic & Partners | Baros, Bicakcic & Partners successfully persuaded the High Commercial Court in Banja Luka to uphold a decision obliging Addiko Bank to pay Vucko d.o.o. Jahorina a total of over BAM 1 million in damages, interest, and court costs. | BAM1million | Bosnia and Herzegovina | Here |
12-May | Maric & Co. | Maric & Co advised the European Investment Bank on a loan to Intesa Sanpaolo Bank in Bosnia and Herzegovina. | EUR60million | Bosnia and Herzegovina | Here |
22-May | Maric & Co. | Maric & Co advised Shandong International and its Bosnian subsidiary SDHS-CSI BH Banja Luka on the Banja Luka-Prijedor-Novi Grad highway construction project. | EUR300million | Bosnia and Herzegovina | Here |
16-Jun | Law Firm Sajic | Law Firm Sajic represented Del Mestri, the founder of the first private elementary school on the territory of the Republic of Srpska, before the Ministry of Education and Culture of Republic of Srpska and before the registration court. | N/A | Bosnia and Herzegovina | |
20-Aug | Maric & Co. | Maric & Co successfully represented the interests of Swietelsky Baugesellschaft m.b.H in the Constitutional Court of Bosnia and Herzegovina in appellate proceedings regarding a tax dispute against the country's Office for Indirect Taxation. | BAM3million | Bosnia and Herzegovina | Here |
4-Nov | Law Firm Sajic | Law Firm Sajic conducted a data protection impact assesment for SberBank a.d. Banja Luka to help identify and mitigate potential risks to privacy and comply with data protection law when processing personal data. | N/A | Bosnia and Herzegovina | |
24-Dec | Dimitrijevic & Partners; Mihaj Ilic Milanovic; Mikijelj Jankovic & Bogdanovic | Dimitrijevic & Partners, Mihaj Ilic Milanovic, and Mikijelj Jankovic & Bogdanovic successfully represented Bosnia and Herzegovina in an investment arbitration with Naveen Aggarwal, Neeta Gupta, and Usha Industries. | USD30.2million | Bosnia and Herzegovina | Here |
1-Jun | BDK Advokati; De Brauw Blackstone Westbroek; Elvinger Hoss Prussen; Kirkland & Ellis; Linklaters; Maric & Co.; Selih & Partners; Wolf Theiss | Linklaters as the lead advisor, together with Harrisons as Serbian legal counsel, Wolf Theis as Slovenian counsel, and Maric & Co. as Bosnian counsel, assisted JP Morgan Securities, KKR Capital Markets Limited, Credit Suisse Securities, Credit Agricole Corporate and Investment Bank, Banca IMI SpA London Branch, Morgan Staley & Co. International, Raiffeisen Bank International, UniCredit Bank AG, BNP Paribas with a) offering by United Group B.V. of EUR 1.05 billion of fixed and floating rate senior secured notes due 2026 and EUR 575, aggregate principal amount of fixed rate senior secured notes due 2028; and b) the offering by Summer Bidco B.V. of EUR 170 million 9.00%/9.75% Senior HoldCo Pay-If-You-Can PIK Notes due 2025. Kirkland & Ellis acted as the lead law advisors to the United Group B.V. as the issuer; De Brauw Blackstone Westbroek N.V. as Dutch counsel for the issuer and the guarantors; Elvinger Hoss Prussen as Luxembourg counsel for the issuer and the guarantors; BDK as Serbian legal counsel to the issuer; and Selih & Partners as Slovenian counsel for the issuer and the guarantors. | EUR1.795billion | Bosnia and Herzegovina; Bulgaria; Serbia; Slovenia | |
15-Dec | BDK Advokati; De Brauw Blackstone Westbroek; Elvinger Hoss Prussen; Kirkland & Ellis; Linklaters; Maric & Co.; Selih & Partners; Wolf Theiss | Linklaters as the lead advisor, working with Harrisons as Serbian legal counsel, Wolf Theis as Slovenian counsel, and Maric & Co. as Bosnian counsel, assisted JP Morgan, KKR Capital Markets Partners, Credit Suisse Securities, Credit Agricole Corporate and Investment Bank, Intesa Sanpaolo, Morgan Stanley & Co. International, Raiffeisen Bank International, UniCredit Bank AG, BNP Paribas, ING Bank N.V. London Branch with the offering by United Group B.V. of EUR 400 million 4.00% senior secured notes due 2027. Kirkland & Ellis acted as the lead law advisors to the United Group B.V. as the issuer; De Brauw Blackstone Westbroek N.V. as Dutch counsel for the issuer and the guarantors; Elvinger Hoss Prussen as Luxembourg counsel for the issuer and the guarantors; BDK as Serbian legal counsel to the issuer; and Selih & Partners as Slovenian counsel for the issuer and the guarantors. | EUR400million | Bosnia and Herzegovina; Bulgaria; Serbia; Slovenia | |
14-Sep | DWF; Kinstellar; Law Firm Sajic | Kinstellar's Belgrade Office successfully advised the Serbian Orthodox Church on a case heard by an English High Court regarding claims of alleged abuse by clergymen in Serbia, Bosnia-Herzegovina, and Croatia. DWF and Michael McParland, QC, also provided legal assistance to the Church in the UK. Law Firm Sajic acted as legal consultant for Kinstellar. | N/A | Bosnia and Herzegovina; Croatia; Serbia | Here |
5-Mar | Kinstellar; Law Firm Sajic | Kinstellar and Law Firm Sajic advised Nova Ljubljanska Banka d.d. on the conclusion of a share purchase agreement with the Republic of Serbia for the acquisition of an 83.23% ordinary shareholding in Komercijalna Banka a.d. Beograd. | N/A | Bosnia and Herzegovina; Kosovo; Montenegro; North Macedonia; Serbia; Slovenia | Here |
26-Aug | DLA Piper; Miro Senica | Miro Senica and DLA Piper assisted Updata Partners with the legal due diligence of Slovenia's HYCU d.o.o., related to Updata Partners' potential acquisition of a controlling interest in HYCU, d.o.o.'s parent compamy, HYCU, Inc. | N/A | Bosnia and Herzegovina; Serbia; Slovenia | |
16-Jan | Djingov, Gouginski, Kyutchukov & Velichkov | DGKV successfully defended the interests of Mayoral Moda Infantil S.A. and its Bulgarian subsidiary Mayoral Bulgaria EOOD before the Bulgarian Commission for Protection of Competition in a case brought by Comsed involving allegations of superior bargaining position. | N/A | Bulgaria | Here |
23-Jan | Kirkland & Ellis; Linklaters; Shchoenherr; Wolf Theiss | Schoenherr and Kirkland & Ellis advised the United Group on Bulgarian legal aspects of its EUR 1.675 billion bonds issuance and on the structuring of the Bulgarian security package. The financing was related to its acquisition of the Bulgarian Telecommunications Company / Vivacom. Linklaters and Wolf Theiss advised global coordinator and physical bookrunner J.P. Morgan. | EUR1.675billion | Bulgaria | |
27-Jan | Georgiev, Todorov & Co. | Georgiev, Todorov & Co successfully defended the interests of Multi-profile Hospital for Active Treatment Doverie against Bulgaria's National Health Insurance Fund in a dispute involving payment for medical care provided by the hospital to health-insured persons above the limits set by the NHIF. | N/A | Bulgaria | Here |
29-Jan | Kambourov & Partners | Kambourov & Partners advised Spain's Bankia bank on a loan portfolio transfer in which part of the receivables was secured by collateral provided by Bulgarian companies. | N/A | Bulgaria | Here |
31-Jan | Schoenherr | Schoenherr advised OMV Petrom on the competition law aspects of its acquisition of a participation in the Han Asparuh exploration licence in Bulgaria. | N/A | Bulgaria | |
6-Feb | Kinstellar | Kinstellar advised GTC on its lease of of 4,000 square meters in the Advance Business Center II, an office building in Sofia, Bulgaria, that is expected to open near the end of this year. | N/A | Bulgaria | Here |
11-Feb | Tokushev And Partners | Tokushev and Partners advised DZI - General Insurance on its acquisition of Mall Varna from Hydrostroy. | EUR16million | Bulgaria | Here |
13-Feb | Kambourov & Partners | Kambourov & Partners advised Yotpo on its acquisition of SMSBump. | N/A | Bulgaria | Here |
14-Feb | CMS; Dinova, Rusev & Partners | CMS advised OTP Bank and DSK Bank on the refinancing of a shopping mall. Dinova, Rusev & Partners advised the borrower. | EUR85million | Bulgaria | |
17-Feb | CMS | CMS helped Korea's SDN Company Ltd regain control over photo-voltaic producer EU Sunday AD. | N/A | Bulgaria | Here |
20-Feb | Georgiev, Todorov & Co. | Georgiev, Todorov & Co successfully defended the rights of Multi-Profile hospital for Active Treatment Europe against the Ministry of Health of Bulgaria. | N/A | Bulgaria | Here |
11-Mar | Kinstellar | Kinstellar advised the EBRD on its first loan under the EUR 200 million Bulgarian Water Sector Financing Framework to Ruse Water Supply and Sanitation Company. | EUR200million | Bulgaria | Here |
17-Mar | Kambourov & Partners; Wolf Theiss | Kambourov & Partners advised DS Smith on Bulgarian aspects of the sale of it plastic packaging business to Liquibox. Wolf Theiss advised Liquidbox on the deal. | N/A | Bulgaria | Here |
17-Mar | D'Ornano Partners; Schoenherr | D'Ornano Partners advised the Groupama Group on its acquisition of Express Life Bulgaria IJSC, a member of the OTP Group. Schoenherr advised the OTP Group on the deal. | N/A | Bulgaria | Here |
26-Mar | Tsvetkova Bebov Komarevski | Tsvetkova Bebov Komarevski advised Eleven Capital on its IPO. | N/A | Bulgaria | Here |
27-Mar | Kambourov & Partners | Kambourov & Partners advised DEV.bg, a Bulgarian IT community developer, on the EUR 200,000 acquisition by hosting and software development company SiteGround of newly issued shares representing a 10% stake in the company. | EUR200000 | Bulgaria | Here |
15-Apr | Schoenherr | Schoenherr advised specialty chemical company Clariant SE on its potential rights in its capacity as a licensor in the event of the insolvency of a Bulgarian company-licensee, a large and complex bio fuel plant. | N/A | Bulgaria | |
23-Apr | Buzeva & Partners; CMS | CMS has helped Bulgaria's Global Biome settle a dispute with the Sustainable Energy Development Fund related to recent changes to Bulgarian legislation. The SEDF was advised by Buzeva & Partners. | N/A | Bulgaria | Here |
6-May | Georgiev, Todorov & Co. | Georgiev, Todorov & Co successfully defended the rights of concessionaire BMF Port Burgas - Burgas East 2 and Burgas West port terminals - in an appeal of the Energy and Water Regulatory Commission's decision in a dispute concerning direct connection to electricity grids. | N/A | Bulgaria | Here |
12-May | CMS | CMS Sofia advised Korean investors KOSEP and SDN on a additional EUR 10 million financing obtained from UniCredit Bulbank AD, Expressbank AD, and DSK Bank EAD for two 42 MWp photovoltaic projects in Bulgaria. CMS Vienna advised the lenders. | EUR10million | Bulgaria | Here |
28-May | CMS | CMS advised Korea's Solarian Holdings Ltd. on the acquisition of a 5 MW photovoltaic power plant in Bulgaria from FEC Perun. | N/A | Bulgaria | Here |
15-Jun | Kambourov & Partners; Kinstellar | Kinstellar and Kambourov & Partners served as legal counsel to the SOF Connect consortium on litigation related to its successful participation in the tender that resulted in its receiving the 35-year concession to operate the Sofia airport. | N/A | Bulgaria | Here |
18-Jun | Boyanov & Co; Kinstellar | Kinstellar advised regional property developer Globe Trade Center on negotiations with Germany's Commerzbank to lease 3,500 square meters of space at Sofia' Advance Business Center II office building. Boyanov & Co advised Commerzbank on the deal. | N/A | Bulgaria | Here |
19-Jun | Schoenher | Schoenherr advised the Balkan Advisory Company in a dispute with TBI Bank concerning an IPO. | N/A | Bulgaria | |
22-Jun | Georgiev, Todorov & Co. | Georgiev, Todorov & Co advised COMSED JSC, the largest retail chain for toys and children's accessories in Bulgaria, on a change in the ownership structure of the company. | EUR1million | Bulgaria | Here |
26-Jun | Georgiev, Todorov & Co. | Georgiev, Todorov & Co successfully represented the Port of Burgas on its appeal of a decision of the Energy and Water Regulatory Commission regarding a connection to Bulgaria's national electricity transmission grid. | N/A | Bulgaria | Here |
1-Jul | CMS; Terziyski & Partners Legal Partnership | CMS acted for private property investor Strategy Solution Ltd. on its EUR 1.4 million acquisition of a landmark office building in Sofia, Bulgaria, from six private individuals. Terziyski & Partners advised the sellers. | N/A | Bulgaria | Here |
8-Jul | Kinstellar | Kinstellar advised Silversmith Capital Partners, a Boston-based growth equity firm, on Appfire's acquisition of Botron Software, a Bulgaria-based provider of tools that enable enterprise-level change and configuration management within the Jira software platform. | N/A | Bulgaria | Here |
14-Jul | Boyanov & Co | Boyanov & Co. advised the Valea Foundation on the acquisition of a minority capital package in FIB Bank. | N/A | Bulgaria | Here |
15-Jul | Dimitrov Petrov & Co. | Dimitrov, Petrov & Co. assisted with the spin-off of CETIN Bulgaria from PPF Telenor. | N/A | Bulgaria | Here |
17-Jul | Djingov, Gouginski, Kyutchukov & Velichkov | DGKV advised Bulgarian start-up Nasekomo on the investment into the company of EUR 4 million from VC funds Morningside Hill and New Vision 3 backed by the Fund of Funds in Bulgaria. | EUR4million | Bulgaria | Here |
17-Jul | Kinstellar | Kinstellar advised OTP Bank and its Bulgarian subsidiary, DSK Bank, on a EUR 25 million loan provided to Balkan Business Center AD for the construction and operation of the Balkan Business Center office complex in Sofia. | EUR25million | Bulgaria | Here |
21-Jul | Georgiev, Todorov & Co. | Georgiev, Todorov & Co. successfully represented Sofia's Acibadem City Clinic Multidisciplinary Hospital for Active Treatment Tokuda EAD in a claim against Bulgaria's National Health Insurance Fund for payment for medical care provided by the hospital to health-insured persons above the NHIF's limits. | N/A | Bulgaria | Here |
27-Jul | CMS; Eurolex Bulgaria | Eurolex Bulgaria and CMS advised Trace Group Holding and Balkantel - members of the Plovdiv Railway Project Consortium - on their successful participation in a tender for a EUR 45 million railway public procurement project in Bulgaria. | EUR45million | Bulgaria | Here |
30-Jul | Dimitrov Petrov & Co.; Vladimirov Kiskinov | Dimitrov, Petrov & Co. advised Team.blue on its acquisition of the Bulgarian web hosting company SuperHosting. The Vladimirov Kiskinov law firm advised SuperHosting on the deal. | N/A | Bulgaria | Here |
31-Jul | Boyanov & Co | Boyanov & Co successfully represented Organic Land Corporation EOOD, a Bulgarian subsidiary of Tradin Organic B.V., in litigation against an unidentified agricultural company. | N/A | Bulgaria | Here |
3-Aug | Lacore; Tsvetkova Bebov Komarevski | Separate teams from Tsvetkova Bebov Komarevski advised both EnduroSat and Freigeist Capital on the latter's investment into the former. Lacore Rechtsanwalte was German counsel to Freigeist Capital. | N/A | Bulgaria | Here |
5-Aug | Hengeler Mueller; Orrick Herrington & Sutcliffe; Schoenherr | Schoenherr and Hengeler Mueller advised Schneider Electric SE on the Bulgarian legal aspects of the acquisition of ProLeiT AG. Orrick Herrington & Sutcliffe advised the target. | N/A | Bulgaria | |
7-Aug | CMS; Mamo TCV Advocates; Maples Group; Reed Smith; Wolf Theiss | CMS advised OTP Bank, DSK Bank, and Eurobank on the EUR 110 million refinancing of the Business Park Sofia with Arco Capital Corporation. Reed Smith and Wolf Theiss advised Arco Capital on the transaction. Mamo TCV Advocates advised the lenders on Maltese law while Maples Group advised the lenders on Cayman law. | EUR110million | Bulgaria | Here |
13-Aug | Epstein Rosenblum Maoz; Georgiev, Todorov & Co. | Georgiev Todorov & Co. advised Bulgaria's Office Sgradi EOOD on the purchase of 50% of the shares of Medical Center-On Clinic Bulgaria AD from the Netherlands-based On Clinic Advanced Medical Institute B.V. The seller was reportedly advised by Israel's Epstein Rosenblum Maoz. | N/A | Bulgaria | Here |
14-Aug | Tokushev and Partners | Tokushev and Partners advised Intercapital Property Development REIT on its initial public offering of company shares worth over BGN 24 million. | BGN24million | Bulgaria | Here |
18-Aug | Gugushev & Partners; Shearman & Sterling; Wolf Theiss | Gugushev & Partners acted as the Bulgarian counsel to several initial purchasers represented by Barclays Capital Inc. in relation to the USD 750 million note offering by Sensata Technologies, Inc., USA. Shearman & Sterling was the lead counsel to the purchasers and Wolf Theiss was the counsel to Sensata. | USD750million | Bulgaria | |
18-Aug | Gugushev & Partners | Gugushev & Partners Law Office successfully represented the National Railway Infrastructure Company before a Court of Arbitration ad hoc to the Bulgarian Chamber of Commerce and Industry with respect to a claim for payments under a FIDIC Contract for Rehabilitation and Electrification of the Railway Plovdiv-Svilengrad. | EUR36million | Bulgaria | |
21-Aug | CMS | CMS advised Korea's Solarian Holdings Ltd. on the acquisition of a 2.25 Megawatt photovoltaic power plant in Bulgaria from Julian Torchanov and Mat Ltd. | N/A | Bulgaria | Here |
8-Sep | Herbert Smith; Schoenherr | Schoenherr advised BNP Paribas S.A. Citibank NA, London Branch, and Black Sea Trade and Development Bank on Bulgarian legal aspects of a EUR 90 million syndicated credit facility extended to Oliva AD and Buildcom EOOD, as well as on the establishment of a Bulgarian security package for the facility. Herbert Smith Freehills acted as English law counsel to the banks. | EUR90million | Bulgaria | Here |
9-Sep | Djingov, Gouginski, Kyutchukov & Velichkov; Tokushev and Partners | Tokushev and Partners advised Oliva AD, the largest grain trader and oilseeds crusher in Bulgaria, on its acquisition of all long-term assets of the Kaliakra plant in Dobrich, Bulgaria, from Kaliakra AD, the Bulgarian subsidiary of Bunge. Djingov, Gouginski, Kyutchukov, and Velichkov advised Kaliakra on the deal. | USD2.3million | Bulgaria | Here |
15-Sep | Allen & Overy; CMS; Memery Crystal; Schoenherr; Spasov & Bratanov | CMS advised ACWA Power, Blackrock, and Crescent Capital on their sale of ACWA Power CF Karad PV Park and NOMAC Bulgaria, which operate the 60 MWp Karadzhalovo photovoltaic plant in Bulgaria, to Enery Development GmbH. Schoenherr and Memery Crystal advised the buyer on the deal, including on one of the first ever commercial refinancing of an existing financing granted by the International Finance Corporation (IFC) and the U.S. International Development Finance Corporation (DFC) by a EUR 95 million bond issue under Austrian law and via intra-group lendings as well as on the concurrent acquisition financing. Allen & Overy and Spasov & Bratanov advised to the existing lenders - IFC and DFC. | EUR95million | Bulgaria | Here |
21-Sep | Djingov, Gouginski, Kyutchukov & Velichkov | Djingov, Gouginski, Kyutchukov & Velichkov advised OTP Bank and DSK Bank on financing provided to Minstroy Properties EOOD for the development of NV Tower, a high-rise office building in Sofia. | N/A | Bulgaria | Here |
22-Sep | Kinstellar | Kinstellar advised the EBRD on a EUR 40 million agreement with Raiffeisebank Bulgaria. | EUR40million | Bulgaria | Here |
25-Sep | Djingov, Gouginski, Kyutchukov & Velichkov; Jordanov, Valkov & Partners | DGKV advised Dow Jones International on the execution of a lease agreement for the company's new office in Sofia. The lessor, T.I.M-X OOD, was advised by the Jordanov, Valkov & Partners law firm. | N/A | Bulgaria | Here |
25-Sep | Djingov, Gouginski, Kyutchukov & Velichkov | DGKV advised Sitel Bulgaria on extending ite lease and renegotiating certain lease provisions necessitated by the COVID-19 pandemic. | N/A | Bulgaria | Here |
9-Oct | Clifford Chance; Djingov, Gouginski, Kyutchukov & Velichkov; Linklaters; Tsvetkova Bebov Komarevski | Tsvetkova Bebov Komarevski and Clifford Chance advised the Republic of Bulgaria on its dual tranche EUR 2.5 billion eurobond issuance. DGKV and Linklaters advised lead managers Citi, JP Morgan, BNP Paribas, and Unicredit. | EUR2.5billion | Bulgaria | Here |
15-Oct | CMS | CMS advised the Italian-Saudi Arabian Arkad Consortium on the amendment and supplement of a public procurement agreement for materials and equipment, investment design-phase detailed design, construction, and commissioning of the Balkan Stream gas pipeline project. | N/A | Bulgaria | Here |
20-Oct | CMS | CMS successfully represented ASM-BG Investicii in a dispute with ESO EAD, Bulgaria's state-owned electricity transmission system operator, heard by the Arbitration Court of the Bulgarian Chamber of Commerce and Industry. | N/A | Bulgaria | Here |
23-Oct | CMS; Memery Crystal; Schoenherr | Schoenherr advised the MET Group on the acquisition of a 100% stake in a 42MW wind park in the Kavarna region of Bulgaria from Enel Green Power. Memery Crystal provided English law advice to the MET Group. CMS advised Enel Green Power on the transaction | N/A | Bulgaria | Here |
6-Nov | Hristov Partners | Hristov & Partners advised MTD Products, an Ohio-based manufacturer of outdoor power and lawn care equipment, on the restructuring of its business operations in Bulgaria. | N/A | Bulgaria | Here |
13-Nov | Djingov, Gouginski, Kyutchukov & Velichkov; Go2Law; Vedder Price | Go2Law and Djingov, Gouginski, Kyutchukov & Velichkov advised Integral Venture Partners on an unspecified investment in Bulgarian telecommunications company Bulsatcom. Vedder Price advised selling shareholders Blantyre Capital and the EBRD. | N/A | Bulgaria | Here |
18-Nov | Gugushev & Partners | Gugushev & Partners helped Fr. Lurssen Werft GmbH & Co KG, part of Northern Germany's Lurssen shipyard group, win a public tender for the supply of two multipurpose modular patrol vessels to the Bulgarian Navy. | EUR500million | Bulgaria | Here |
27-Nov | Boyanov & Co | Boyanov & Co helped Ideal Standard Vidima obtain a loan of EUR 65 million, with EUR 45 million coming the DSK Bank and another EUR 20 million from the United Bulgarian Bank. | EUR65million | Bulgaria | Here |
29-Dec | Kinstellar | Kinstellar advised Allianz Bulgaria on its lease of office space from Park Lane Developments in Sofia. | N/A | Bulgaria | Here |
21-Oct | Latham & Watkins; Paul Hastings; Schoenherr | Schoenherr and Paul Hastings advised lender and administrative agent Monroe Capital and a group of companies affiliated with Marlin Equity Partners (in their capacities as Borrowers/Guarantors), on a USD 270 million financing for the acquisition of hospitality management technology players Fourth and HotSchedules, which were then subsequently merged into Fourth. Latham & Watkins advised the obligators and Fourth. | EUR270million | Bulgaria | |
4-Dec | Schoenherr | Schoenherr advised Leoni AG on its entry into the Bulgarian market and the lease and construction of a production factory in Bulgaria. | EUR32million | Bulgaria | |
27-Mar | Schoenherr; Wolf Theiss | Schoenherr advised Enery Power Holding GmbH on the Bulgarian legal aspects of a EUR 35 million mezzanine bond issuance used to finance its acquisition of a Bulgarian solar park. Wolf Theiss advised the bondholders. | EUR35million | Bulgaria; Austria | |
17-Apr | Dentons; Djingov, Gouginski, Kyutchukov & Velichkov; Ilej & Partners; Karanovic & Partners; Schoenherr | Dentons, DGKV, Karanovic & Partners, and Ilej & Partners in cooperation with Karanovic & Partners advised Hungary's Optima Befektesi Alapkezelo on its acquisition of a 61.49% share in Globe Trade Centre S.A. from Lone Star Funds. Schoenherr advised the sellers on the deal. | N/A | Bulgaria; Croatia; Poland; Romania; Serbia | Here |
1-Feb | Wolf Theiss | Wolf Theiss Bucharest advised Addiko Bank, Privredna Banka Zagreb, Zagrebacka Banka, and Raiffeisen Austria regarding the club loan of EUR 120 million to Croatian retail company Orbico d.o.o. and subsidiaries. | EUR120million | Bulgaria; Croatia; Poland; Romania; Slovenia | |
31-Mar | Hogan Lovells; Schoenherr; Wolf Theiss | Schoenherr and Hogan Lovells advised Ares Management Limited on the EUR 75.78 million financing for Kohlberg's acquisition of the K2 Sports and Marker Dalbello Volkl businesses in the Czech Republic and Bulgaria. Wolf Theiss Bulgaria advised the borrower and the Bulgarian pledgors. | EUR75.78million | Bulgaria; Czech Republic | |
1-Feb | Lakatos, Koves & Partners; Weil, Gotshal & Manges; White & Case | LKT advised Walmark on Hungarian matters related to the sale of its Pharmavit business to Supremax - a carve-out transaction resulting from the sale of Walmark to Stada due to competition considerations. Kinstellar advised Supremax. LKT, Weil, Gotshal & Manges, and White & Case acted as advisors to MidEuropa on the original Walmark and Strada deal. | N/A | Bulgaria; Czech Republic; Hungary; Poland; Romania; Slovakia | |
16-Nov | Goodwin Procter; Kinstellar; Linklaters | Kinstellar and Goodwin Procter advised GTT Communications on the USD 2.15 billion sale of its business infrastructure in Central, Southern, and Eastern Europe to I Squared Capital. Linklaters advised the buyer on the deal. | USD2.15billion | Bulgaria; Czech Republic; Hungary; Romania; Serbia; Slovakia; Ukraine | Here |
1-Sep | Drakopoulos; Kambourov & Partners; Lambadarios Law Firm | Kambourov & Partners and Drakopoulos advised Bulgartransgaz EAD on its acquisition of a 20% stake in Gastrade S.A. Lambadarios Law Firm advised the Public Gas Corporation of Greece. | EUR12.5million | Bulgaria; Greece | Here |
27-Feb | Akol Law Firm; Georgiev, Todorov & Co.; Kolcuoglu Demirkan Kocakli; Yordanov & Rachev | Georgiev, Todorov & Co., Akol Law Firm, and Yordanov & Rachev advised Fleet Services, which currently operates through GPS Bulgaria and GPS Systems Macedonia, on the purchase of all shares of the capital of Turkish GPS company Mobiliz Bilgi ve Iletisim Teknolojileri Sirketi. Kolcuoglu Demirkan Kocakli advised the sellers. | N/A | Bulgaria; Macedonia; Turkey | |
5-Feb | Noerr; Penkov Markov & Partners | Noerr and Penkov, Markov & Partners advised private equity firm Aurelius Equity Opportunities SE & Co. KGaA on the acquisition of the Renewable Power Systems and Protection Relays businesses from Woodward, Inc. | N/A | Bulgaria; Poland | Here |
30-Jan | CMS; EY Law | CMS advised Hyundai Electric & Energy Systems on the sale of its Bulgarian subsidiary Hyundai Heavy Industries Co. Bulgaria AD to Russia's SVEL Group. EY Law Russia advised the buyers. | N/A | Bulgaria; Russia | Here |
31-Dec | Arsov Natchev Ganeva; CMS; Dentons; Djingov, Gouginski, Kyutchukov & Velichkov; Kpmg Legal; Latham & Watkins; Linklaters; Tsvetkova Bebov Komarevski | CMS and Arsov Natchev Ganeva advised contractor Arkad on the Balkan Stream Gas Pipeline project, which was completed at the end of December, 2020. Dentons, KPMG Legal, Tsvetkova Bebov Komarevski, and Latham & Watkins also advised the contractor on the deal. Linklaters and DGKV advised unspecified lenders on financing for the project. | EUR1.1billion | Bulgaria; Russia | Here |
21-Oct | Andric Law Office; CMS; Doklestic Repic & Gajin; Eurolex Bulgaria | CMS Sofia and Doklestic Repic & Gajin have advised Balkantel on its participation with the Trace Group in a EUR 60 million modernization and rehabilitation project of the Nis-Brestovac railway in southern Serbia. The Trace Group was advised by Eurolex Bulgaria and the Andric Law Office. | EUR60million | Bulgaria; Serbia | Here |
1-Mar | Akol Law Firm; Kolcuoglu Demirkan Kocakli | Akol Law Firm assisted Sovos with its acquisition of Foriba. Kolcuoglu Demirkan Kocakli advised the sellers. | USD53million | Bulgaria; Turkey | |
27-Mar | Kinstellar | Kinstellar advised Earlybird Venture Capital on its EUR 3 million seed funding of fintech startup Payhawk, a paperless corporate card used for simplifying expenses for businesses. | EUR3million | Bulgaria; Turkey | Here |
11-Aug | Aequo; CMS; Harney's; Jipyong; Sayenko Kharenko | CMS advised the Export-Import Bank of Korea on a USD 36 million financing deal with Grain Terminal Holdings - a Singapore-based joint venture between Posco International and the Orexim Group. Posco International was advised by Aequo and South Korea's Jipyong law firm, and the Orexim Group was advised by Sayenko Kharenko and Harneys' Cyprus office. | USD36million | Bulgaria; Ukraine | Here |
23-Oct | Akol Law Firm; DLA Piper; Herguner Bilgen Ozeke; Kambourov & Partners | DLA Piper advised Polhem Infra on Ukrainian aspects of its acquisition of telecommunication services provider Telia Carrier from the Telia Company. Kambourov & Partners acted as Bulgarian advisor to Polhem Infra on the deal. Herguner Bilgen Ozeke advised Telia and Akol Law Firm advised Polhem in Turkey. | SEK9.4million | Bulgaria; Ukraine | Here |
31-Mar | Paul Hastings; Schoenherr | Schoenherr and Paul Hastings advised Monroe Capital Investments on a USD 250 million loan to Fourth UK and on the security package over the assets of local subsidiary Fourth Bulgaria EOOD. | USD250milion | Bulgaria; United States of America | |
24-Jan | Miskovic & Miskovic | Miskovic & Miskovic advised Badel 1862 d.d. Zagreb on the structure and takeover process of target Vinoplod-Vinarija d.d. Sibenik in pre-bankruptcy proceedings. | N/A | Croatia | |
27-Jan | Tus & Andrijanic | Tus & Andrijanic advised JGL d.d. on its HRK 130 million issuance of corporate bonds. The agent for the issue was Privredna Banka Zagreb d.d. | HRK130million | Croatia | Here |
18-Feb | Kovacevic Prpic Simeunovic | KPS advised a syndicate of the Croatian Bank for Reconstruction and Development, OTP Banka d.d., Privredna Banka Zagreb-Dionicko Drustvo, and Zagrebacka Banka d.d. on financing of up to HRK 537 million to Zagrebacki Elektricni Tramvaj d.o.o. for the construction of a Zagreb-Sljeme cable car line with carpark. | EUR72million | Croatia | |
21-Feb | Cipcic-Bragadin Mesic & Associates; Marohnic Tomek & Gjoic; Nozdrovicky, Suvert & Co.; Wolf Theiss; Zeljka Velic Dvorscak & Silvije Skerlev | Cipcic-Bragadin Mesic and Associates advised Nafta a.s. on the acquisition of 50% of investors' rights and sharing obligations under the 2016 Production Sharing Agreement entered into between Vermilion Zagreb Exploration and the Government of the Republic of Croatia. Marohnic Tomek & Gjoic, Zeljka Velic Dvorscak & Silvije Skerlev, and Nozdrovicky, Suvert & Co also advised Nafta on the deal, while Wolf Theiss advised Vermilion. | N/A | Croatia | Here |
17-Mar | Cipcic-Bragadin Mesic & Associates | Cipcic-Bragadin Mesic & Associates executed a public procurement advisory agreement with the Croatian Ministry of Public Administration in relation to the implementation of an e-Business project. | HRK50million | Croatia | Here |
31-Mar | Cipcic-Bragadin Mesic & Associates | Cipcic-Bragadin Mesic & Associates announced the launch of a "Covid-19 + Zagreb Earthquake" pro bono project to help those affected by Covid-19 and/or the earthquake that rocked the Croatian capital on March 22, 2020. | HRK1million | Croatia | Here |
29-Apr | Lovric Novokmet Smrcek; Wolf Theiss | Lovric Novokmet Smrcek advised I4 Invention and Miodrag Mircetic on the sale of a majority shareholding in Tradeticity DOO to Italian-listed company Antares Vision, which was advised by Wolf Theiss. | N/A | Croatia | Here |
30-Apr | Freshfields; Savoric & Partners | Freshfields advised agent Unicredit Bank AG and Bayerische Landesbank, BNP Paribas S.A., and Commerzbank Aktiengesellschaft in connection with financing for Flixmobility GmbH and its subsidiaries. Savoric & Partners advised on Croatian law. | N/A | Croatia | |
13-May | Tus & Andrijanic; Wuersch & Gering | Croatia's Tus & Andrijanic law firm, acting with New York's Wuersch & Gering lw firm, advised Budapest-based Lead Ventures Plc. on it EUR 3 million acquisition of an unspecified stake in insurtech start-up Amodo d.o.o. | EUR3million | Croatia | Here |
19-May | Babic & Partners; BDV Legal; Go2Law; Taylor Wessing; Wolf Theiss | Go2Law and BDV advised Optimapharm founders Igor and Gordana Cicak and Wolf Theiss advised investor Mezzanine Management on the sale of Optimapharm to the Rohatyn Group. Babic & Partners, Taylor Wessing, and Nauta Dutilh advised the Rohatyn Group on the deal. | N/A | Croatia | Here |
29-May | Bogdanovic, Dolicki & Partners; Savoric & Partners | Savoric & Partners advised Generali on its acquisition of the insurance portfolio of Izvor Osiguranje d.d. The seller was advised by Bogdanovic, Dolicki & Partners. | N/A | Croatia | |
1-Jun | Kovacevic Prpic Simeunovic | KPS was engaged by the Ministry of Finance of the Republic of Croatia to draft a regulation defining criteria for expert valuation and examination of publicly funded investment projects and related instructions for budget entities at the national and local (regional) levels. | N/A | Croatia | |
9-Jun | Kovacevic Prpic Simeunovic; Pillsbury Winthrop Shaw Pittman | KPS advised the lessor, owned by the World Star Aviation Group, on the delivery and lease of one Airbus A319-112 aircraft toÊ Croatian national air carrier Croatia Airlines. Pillsbury Winthrop Shaw Pittman advised the lessor on English law. | N/A | Croatia | |
9-Jul | Baker Mckenzie; Divjak Topic Bahtijarevic & Krka | DTB and Baker McKenzie advised mobile game developer Playrix on the acquisition of Croatian gaming studio Cateia Games. | N/A | Croatia | Here |
31-Aug | Latham & Watkins; Morrison Foerster; Savoric & Partners | Savoric & Partners advised One Equity Partners on Croatian employment matters related to a project involving a strategic capital investment of over USD 200 million in global IT and telecommunications company Infobip. Morrison Foerster advised Infobip. Latham & Watkins acted as global advisor to One Equity Partners. | USD200million | Croatia | |
7-Sep | Beiten Burkhardt | Beiten Burkhardt advised Dr. Zwiebelhofer GmbH on the acquisition of two Croatian companies, KM Kovnica and KM Alati, from an unidentified seller, and on the two companies' reintegration into the Konig Metall Group, from which they had been sold in 2013. | N/A | Croatia | Here |
9-Sep | CMS; Miskovic & Miskovic | Miskovic & Miskovic advised Croatian design and development agency Infinum, and its shareholders, in a joint venture with Porsche Digital GmbH, the digital unit of Porsche AG. CMS advised Porsche Digital GmbH. | EUR10million | Croatia | |
28-Sep | Divjak Topic Bahtijarevic & Krka; Mamic Peric Reberski Rimac | DTB advised Interxion on its acquisition of Altus IT in Croatia. Mamic Peric Reberski Rimac advised Altus IT on the deal. | N/A | Croatia | Here |
30-Sep | DLA Piper; Glinska & Miskovic; Latham & Watkins; Savoric & Partners | Savoric & Partners, working alongside Latham & Watkins, advised Nanobit, a Croatian video game developer, on its acquisition by Sweden's Stillfront Group. The buyer was advised by Glinska & Miskovic and DLA Piper. | USD148million | Croatia | |
9-Oct | CMS; Schoenherr | Schoenherr advised S Immo AG on the acquisition of the Zagrebtower office complex from CA Immobilien Anlagen AG. CMS advised the sellers on the deal. | N/A | Croatia | Here |
10-Oct | Savoric & Partners | Savoric & Partners acted for a syndicate of Privredna Banka Zagreb d.d., Zagrebacka Banka d.d., Sberbank d.d., and Croatian Bank for Reconstruction and Development, and agent Privredna Banka Zagreb d.d., in relation to financing granted to Valamar Riviera d.d. | EUR66million | Croatia | |
21-Oct | Divjak Topic Bahtijarevic & Krka; Krehic & Partners | DTB advised US-based Devolver Digital on its acquisition of Croatian independent game development company Croteam. Krehic & Partners in cooperation with Deloitte Legal advised Croteam on the deal. | N/A | Croatia | Here |
31-Oct | Buterin & Posavec; Savoric & Partners | Savoric & Partners acted for Enterprise Fund VII, a private equity fund managed by Enterprise Investors, in its acquisition of the remaining 35% stake in Croatia's Pan-Pek bakery. Buterin & Posavec advised the seller. | N/A | Croatia | |
9-Nov | Helena Sjaus; Kovacevic Prpic Simeunovic | KPS advised Privredna Banka Zagreb-Dionicko Drustvo, Sberbank d.d., and Raiffeisenbank Austria d.d. on financing for the construction of a new shopping mall. Solo practitioner Helena Sjaus advised the borrower. | EUR17.2million | Croatia | |
26-Nov | Marohnic Tomek & Gjoic; Wolf Theiss | Marohnic, Tomek & Gjoic advised LCN Capital Partners on its acquisition of five Emmezeta retail and warehouse units in Croatia. Josip Martinic in cooperation with Wolf Theiss reportedly advised the seller on the deal. | N/A | Croatia | Here |
30-Nov | Bogdanovic, Dolicki & Partners; Brownstein Hyatt Farber Schreck; Dechert; Kirkland & Ellis; Savoric & Partners | Savoric & Partners and Dechert advised Microblink and its US partner BlinkReceipt, on its receipt of a USD 60 million minority investment led by Silversmith Capital Partners. Brownstein Hyatt Farber Schreck advised the target while Kirkland & Ellis and Bogdanovic, Dolicki & Partners advised Silversmith Capital. | USD60million | Croatia | |
22-Dec | Divjak Topic Bahtijarevic & Krka; Eisenberger & Herzog; Tokic Ivic Sverak | Divjak Topic Bahtijarevic & Krka and Eisenberger & Herzog advised Austrian energy company Kelag on its acquisition of the Orjak wind farm in Croatia from BayWa. Tokic Ivic Sverak advised the seller on the deal. | N/A | Croatia | Here |
30-Dec | Kovacevic Prpic Simeunovic | KPS advised UniCredit on financing for its acquisition of receivables from Officium Partners d.o.o. | EUR24million | Croatia | |
30-Apr | Clifford Chance; Divjak Topic Bahtijarevic & Krka; Savoric & Partners | Savoric & Partners, working alongside Clifford Chance, advised CVC Capital Partners in its acquisition of several companies from the Dogus Group. Divjak Topic Bahtijarevic & Krka advised the seller. | N/A | Croatia; Greece; Montenegro; Turkey | |
23-Nov | Bird & Bird; Cipcic-Bragadin Mesic & Associates; Clifford Chance (Badea); Cobalt; Jadek & Pensa; Karanovic & Partners; Karanovic & Partners (Ilej & Partners) | Cipcic-Bragadin Mesic & Associates assisted global lead counsel Bird & Bird on Pfizer's global business combination with Mylan N.V., involving the spin-off of Pfizer's Upjohn business and a subsequent merger of that business with Mylan N.V. to form a new global generics company called "Viatris." Karanovic & Partners provided local support in Serbia, Jadek & Pensa provided local support in Slovenia, Cobalt provided support in Latvia, and Clifford Chance provided local support in Romania. | N/A | Croatia; Latvia; Romania; Serbia; Slovenia; | Here |
29-May | Allen Overy; Savoric & Partners | Savoric & Partners, working alongside Allen & Overy, advised Powszechna Kasa Oszczednosci Bank Polski S.A., Bank Handlowy w Warszawie S.A., Bank Zachodni WBK S.A., and ING Bank Slaski S.A. in relation to the amendment and restatement of PLN 850 million multi-currency term loan facilities and a revolving facility agreement provided to Press Glass SA and its subsidiaries. | PLN850million | Croatia; Poland | |
8-Oct | ODI Law; Praljak & Svic | ODI Law and Praljak & Svic advised Tokic, a Croatian auto parts retail chain, on the acquisition of all shares in Slovenian tire distribution company Bartog from private individuals Jasna Bartolj Kotar and Darija Bartolj Umek. The sellers were advised by solo practitioners Mihael Prcic and Janez Tekavc. | N/A | Croatia; Slovenia | Here |
9-Dec | Freshfields; Linklaters; ODI Law | Freshfields Bruckhaus Deringer advised the Copenhagen-based payment services provider Nets and its majority owner, Hellman & Friedman, on the EUR 7.8 billion all-share merger of Nets into Italy's paytech group Nexi. ODI Law acted as local advisor to Nexi in Slovenia and Croatia. | EUR7.8billion | Croatia; Slovenia | Here |
12-Feb | Akol Law Firm; Dentons; Mamic Peric Reberski Rimac; Savoric & Partners; White & Case | White & Case advised Mid Europa Partners on the merger of its portfolio company CMC Iletisim ve Cagri Merkezi Hizmetleri A.S. with Meritus Upravljanje d.o.o., part of M+ Group, in return for a 30% equity stake in the combined group. Dentons advisedd the target company. In Croatia, Savoric & Partners advised Mid Europa Partners while Mamic Peric Reberski Rimac advised the target. Akol Law Firm advised Mid Europa in Turkey. | N/A | Croatia; Turkey | Here |
17-Jan | Clifford Chance; Dentons; Simpson Thacher & Bartlett | Dentons and Simpson Thacher advised Round Hill Capital and Blackstone Tactical Opportunities on the sale of a EUR 1.3 billion residential real estate portfolio in the Czech Republic to Swedish real estate company Heimstaden Bostad AB. Clifford Chance advised Heimstaden Bostad on the deal. | EUR1.3billion | Czech Republic | Here |
24-Jan | Kinstellar | Kinstellar advised Czech investment group Portiva on its acquisition of a 5000-square meter retail center in the Czech Republic from Austrian developer Aventin. | CZK250million | Czech Republic | Here |
25-Jan | Frank Bold; Havel & Partners | Havel & Partners advised Finland's Vexve Oy on its acquisition of 100% of Armatury Group a.s., a Czech manufacturer in the heavy industry segment. Frank Bold advised the seller. | N/A | Czech Republic | |
27-Jan | Weinhold Legal | Weinhold Legal advised Czech insurance broker Renomia on its acquisition of FINVOX Financni Sluzby, a Czech company focusing on insurance, credit, and investment mediation. | N/A | Czech Republic | Here |
27-Jan | Kinstellar | Kinstellar advised Youplus Insurance International AG and myLife Lebensversicherung AG, members of Switzerland's Insurevolution Partners insurance group, on the acquisition of Czech and Slovak life and non-life insurance contract portfolios from Basler Sachversicherungs-AG and Basler Lebensversicherungs-AG. | N/A | Czech Republic | Here |
27-Jan | Clifford Chance; Hladky Legal; Kroupahelan | Clifford Chance advised P & O Netherlands B.V. on the EUR 21.5 million sale of its 50% stake in the Technologicky Park Brno business center to the city of Brno. As a result of the deal, the city, which was advised by Hladky Legal and the Kroupahelan Law Firm, became the majority owner of the park. | EUR21.5million | Czech Republic | Here |
1-Feb | Clifford Chance; Eversheds Sutherland | Eversheds Sutherland advised Emma Capital in connection with its acquisition of assisted reproduction clinics and the establishment of a joint venture with the sellers. Clifford Chance advised the sellers. | N/A | Czech Republic | |
4-Feb | Kocian Solc Balastik | KSB's helped the Experientia Foundation "transform and professionalize." | N/A | Czech Republic | Here |
4-Feb | BPV Braun Partners | BPV Braun Partners advised Carrier Transicold on the sale of its Czech subsidiary. | N/A | Czech Republic | Here |
5-Feb | JSK; Kinstellar | Kinstellar advised Raiffeisenbank on financing for KWR Czech's acquisition of DCK Holoubkov, a company that produces all-plastic outdoor low-voltage distribution switchboards, from two unnamed individuals. KWR Czech, owned by BHS Fund II Private Equity, was advised by JSK on the deal. | N/A | Czech Republic | Here |
13-Feb | Weinhold Legal | Weinhold Legal advised Ceska Posta on its CZK 353 million sale of the St. Gabriel Monastery to the Cimex Group. | CZK353million | Czech Republic | Here |
14-Feb | BPV Braun Partners; Eversheds Sutherland | BPV Braun Partners advised Unicapital Energy Group on the acquisition of PSP Technicke Sluzby. Eversheds Sutherland advised the sellers on the transaction. | N/A | Czech Republic | Here |
20-Feb | Allen & Overy | Allen & Overy advised sole lead manager JP Morgan on Moneta Money Bank's approximately CZK 2.6 billion domestic subordinated Tier 2 capital bond issuance. | CZK2.6billion | Czech Republic | Here |
29-Feb | PRK Partners | PRK Partners advised Komercni Banka a.s. on financing provided to a joint venture established by Sekyra Group and Ungelt Services for the acquisition of land for the development of residential and commercial projects in Prague. | EUR13.1million | Czech Republic | |
1-Mar | Havel & Partners; Norton Rose Fulbright | Havel & Partners and Norton Rose Fulbright represented Wustenrot & Wurttenbergische AG on the sale of 100% shares in Wustenrot-Stavebni Pojistovna a.s. and Wustenrot Hypotecni Banka a.s. to Moneta Money Bank, a.s. | EUR180million | Czech Republic | |
4-Mar | PwC Legal | PwC Legal advised IBSA Group on the acquisition of its long-term distributor on the Czech market, IBI spol. s r.o. IBI was advised by Solo Practitioners Violeta Jirackova and Rostislav Zak. | N/A | Czech Republic | Here |
16-Mar | Kocian Solc Balastik | Kocian Solc Balastik advised Czech hosting company IGNUM on its acquisition of web hosting and server services provider Stable.cz. | N/A | Czech Republic | Here |
16-Mar | Kocian Solc Balastik | Kocian Solc Balastik advised Solitea on the acquisition of Axiom Provis Int. | N/A | Czech Republic | Here |
17-Mar | Weinhold Legal | Weinhold Legal advised Skolnik Holding s.r.o. on the acquisition of a majority stake in Hobra-Skolnik from Switzerland's Filtrox. | N/A | Czech Republic | Here |
17-Mar | Clifford Chance; Dentons | Clifford Chance advised Heimstaden Bostad AB on its EUR 1.3 billion acquisition of Residomo's residential portfolio, which consists of move 42,000 residential units primarily in the Moravia-Silesia region of the Czech Republic. Dentons advised Residomo on the deal. | EUR1.3billion | Czech Republic | Here |
18-Mar | Kinstellar | Kinstellar helped Portiva acquire Astrid Offices, an administrative center under development in Prague's Holesovice district. | EUR19.5million | Czech Republic | Here |
26-Mar | Allen & Overy; Clifford Chance; Milbank, Tweed, Hadley & Mccloy | Allen & Overy; Dentons; Fenwick & West; White & Case | EUR300million | Czech Republic | Here |
31-Mar | PRK Partners | PRK Partners advised lead manager Komercni Banka a.s. on Equa Bank's mortgage bond issuance under the existing Debt Issuance Programme. | CZK2billion | Czech Republic | |
31-Mar | Johnson Stastny Kramarik; PRK Partners | PRK Partners advised Komercni Banka a.s. in connection with the financing of a large real estate development project in Prague realized by the Finep Group. Johnson Stastny Kramarik advised the borrower. | EUR120million | Czech Republic | |
1-Apr | Eversheds Sutherland; Havel & Partners | Eversheds Sutherland advised the founder of Strojmetal on the sale of his controlling stake in the company to the MTX group. Havel & Partners advised the buyers. | N/A | Czech Republic | |
1-Apr | PRK Partners | PRK Partners advised Komercni Banka a.s. on the financing of a large real-estate residential development project in Prague known as "Kaskady Barrandov." | EUR4.21million | Czech Republic | |
3-Apr | BPV Braun Partners; CEE Attorneys | BPV Braun Partners advised Generali Investments CEE on its acquisition of a residential building in Prague. CEE Attorneys advised the unidentified seller on the deal. | N/A | Czech Republic | Here |
8-Apr | Clifford Chance; Dolecek Advokati | Clifford Chance advised Generali Real Estate on its acquisition of the Kotva Department Store, a 28,000 square meter seven-story building in the Prague city center, from PSN. Dolecek Advokati advised the sellers. | N/A | Czech Republic | Here |
20-Apr | JSK; Mavericks | JSK advised Tilia Impact Ventures and Nation 1 on their investment in Dot Glasses, a provider of a radical new concept for prescription eyeglasses for people in need. The Mavericks law firm advised Dot Glasses on the deal. | N/A | Czech Republic | Here |
20-Apr | Allen & Overy; Eversheds Sutherland; Linklaters; RTPR | Eversheds Sutherland, as Czech and Romanian counsel, and Linklaters, as lead counsel, advised G4S, a British multinational security services company, on its corporate restructuring and subsequent sale of its cash solutions activities to Brink's. Allen & Overy and RTPR advised the buyers. | N/A | Czech Republic | |
24-Apr | Baker Mckenzie | Baker McKenzie advised Kofola CeskoSlovensko on its acquisition of rhe Karlovarska Korunni and Ondrasovka food and beverage companies. | N/A | Czech Republic | Here |
1-May | Clifford Chance; Eversheds Sutherland | Eversheds Sutherland advised DER Touristik Group GmbH, a German-based company and member of REWE group, in connection with their acquisition of the Czech Republic's CK Fische travel agency. Clifford Chance advised the sellers. | N/A | Czech Republic | |
7-May | Weinhold Legal | Weinhold Legal advised technology security start-up Resistant AI on its recent venture financing round. | N/A | Czech Republic | Here |
15-May | Dentons; PwC Legal | PwC Legal advised Varroc Lighting Systems, a Czech manufacturer of headlamps, on the expansion of a syndicate of creditors which had extended the company a EUR 230 million loan. The banking syndicate was advised by Dentons. | EUR230million | Czech Republic | Here |
21-May | Kinstellar | Kinstellar helped CSOB to launch the we.trade finance platform in the Czech Republic. | N/A | Czech Republic | Here |
21-May | GT Legal; Trojan, Dolecek & Partners | GT Legal represented Fragile Media s.r.e. founder Daniel Kafka and the Etnetera Group at the sale of their combined 50% stake in Fragile Media to the Czech KnowLimits media and communications group. Trojan, Dolecek & Partners advised the buyers on the deal. | N/A | Czech Republic | Here |
22-May | Glatzova & Co; Kinstellar | Glatzova & Co advised the KKCG investment group on the sale of Conectart, a call center operator in the Czech Republic, to the Genesis Capital Group. The Prague office of Kinstellar advised the buyers on the deal. | N/A | Czech Republic | Here |
25-May | Travers Smith; Weinhold Legal; Wolf Theiss | Weinhold Legal advised the shareholders of Klikpojisteni.cz, a.s., including the private equity arm of Benson Oak Capital, on the sale of their 100% stake in Klikpojisteni.cz, a.s. to a company majority-owned by TA Associates and minority-owned by MCI EuroVentures. The buyer was advised by Wolf Theiss and Travers Smith. | N/A | Czech Republic | Here |
27-May | Allen & Overy; Dentons | Dentons advised CPI Property Group on a successful tender offer of bonds and the issue of EUR 750 million 2.75% Notes due 2026 under CPI's EUR 8 billion Medium Term Note Program. Allen & Overy advised joint lead managers Credit Suisse Securities (Europe) Limited, Deutsche Bank AG, HSBC Bank plc, Nomura International plc, and Unicredit Bank AG. | EUR750million | Czech Republic | Here |
1-Jun | Eversheds Sutherland; Havel & Partners | Havel & Partners advised 2 JCP on the sale of 70% interest in the company to JET 2, an investment fund within the Jet Investment group, which is owned by Igor Fait. The buyer was advised by Eversheds Sutherland | N/A | Czech Republic | |
1-Jun | Eversheds Sutherland; White & Case | Eversheds Sutherland advised EGAP, the Czech government's export insurer, on its EUR 5 billion COVID-19 rescue program for local companies. White & Case advised the banks. | EUR5billion | Czech Republic | |
3-Jun | Glatzova & Co | Glatzova & Co successfully represented the interests of paper products manufacturer Mondi Steti before the Constitutional Court of the Czech Republic. | N/A | Czech Republic | Here |
5-Jun | Kinstellar | Kinstellar advised US-based Novavax, a late-stage biotechnology company developing next-generation vaccines for serious infectious diseases, on its acquisition of Praha Vaccines a.s. from the Cyrus Poonawalla Group. | USD167million | Czech Republic | Here |
8-Jun | Dentons; Latham & Watkins | Dentons advised Sev.en Energy on the acquisition of US-based metallurgical coal producer Blackhawk Mining. Latham & Watkins advised Blackhawk on the deal. | N/A | Czech Republic | Here |
12-Jun | Kocian Solc Balastik | Kocian Solc Balastik successfully represented the Czech Republic's National Theatre in a rent dispute before the Czech Supreme Court. | N/A | Czech Republic | Here |
15-Jun | Kocian Solc Balastik | Kocian Solc Balastik helped prepare contractual documentation for the Arete investment and real estate group related to the refinancing of the portfolio of its EUR 80 million CEE II sub-fund. | EUR80million | Czech Republic | Here |
16-Jun | Kocian Solc Balastik | Kocian Solc Balastik advised Czech hosting company Ignum, a member of Slovakias WY Group, on the acquisition of the hosting division of Axfone LLC, a development and telecommunications company with branches in Europe, the USA, and Asia. Solo practitioner Richard Sysel advised Axfone on the deal. | N/A | Czech Republic | Here |
16-Jun | Masek, Koci, Aujezdsky; Vyskocil Kroslak a Partneri | Masek, Koci, Aujezdsky advised sports platform Livesport on the acquisition of film portal Kinobox.cz from entrepreneur Peter Vachler, who will remain on as a consultant. Vyskocil, Kroslak a Partneri advised Vachler on the deal. | N/A | Czech Republic | Here |
17-Jun | CMS; Dunovska & Partners | CMS advised Arkance on its acquisition of CAD Studio, a company involved in the digitalization of manufacturing and construction industries in the Czech and Slovak Republics and Hungary, from Autocont, a member of the Aricoma Group. Dunovska & Partners advised the sellers on the deal. | N/A | Czech Republic | Here |
1-Jul | DBK Partners; Havel & Partners | Havel & Partners advised Moufleco Holdings Limited on the the sale of its 45% stake in TEDOM to the CEZ group. DBK Partners advised the buyer. | N/A | Czech Republic | |
6-Jul | Kinstellar; Roedl & Partner; Tarpan Partners | Kinstellar advised Max Aicher GmbH & Co. KG on the acquisition of the enterprises of bankrupt Czech companies Pilsen Steel s.r.o. and Pilsen Estates s.r.o. from insolvency administrator Jaroslav Broz. Tarpan Partners were on the insolvency administrator's team, while Roedl & Partner served as tax advisors to the Max Aicher group. | N/A | Czech Republic | Here |
8-Jul | Kocian Solc Balastik | KSB advised Solitea Holding on the internal merger of thirty companies from the Czech Republic and Slovakia into two national companies. | N/A | Czech Republic | Here |
8-Jul | Kocian Solc Balastik | KSB advised Sandberg Capital on the acquisition of a 35% stake in Revolgy Business Solutions. | N/A | Czech Republic | Here |
9-Jul | Weinhold Legal | Weinhold Legal advised Chropynska Strojirna on the acquisition of a 100% stake in HLS Czech. | N/A | Czech Republic | Here |
10-Jul | Allen & Overy; Go2Law; White & Case | Allen & Overy and Go2Law advised the management of Memsource on the sale of its majority stake to the Carlyle Group. White & Case advised the Carlyle Group. | N/A | Czech Republic | Here |
13-Jul | Clifford Chance | Clifford Chance advised the Nadace Dagmar a Vaclava Havlovych VIZE 97 foundation on multiple intellectual property protection matters. | N/A | Czech Republic | Here |
16-Jul | Havel & Partners; Hengeler Mueller; White & Case | White & Case advised Hungary's MVM on the acquisition of the entire share capital in Innogy Czech Republic from Innogy Beteiligungsholding, a member of the Innogy/E.ON Group. Hengeler Mueller and Havel & Partners advised E.ON on the deal. | N/A | Czech Republic | Here |
23-Jul | Havel & Partners; Schoenherr | Schoenherr advised the LYNXCap Group on acquisition of a Czech-originated NPL portfolio and underlying financing from Gorenjska Banka d.d. in Slovenia. Havel & Partners acted as local counsel to Cirilin One a.s. | EUR8.8million | Czech Republic | |
28-Jul | Grant Thornton; GT Legal; Kocian Solc Balastik | Kocian Solc Balastik advised the Skoda Transportation Group on the acquisition of Ostrava-based Ekova Electric. GT Legal and Grant Thornton advised the seller, Dopravni Podnik Ostrava. | N/A | Czech Republic | Here |
3-Aug | Allen & Overy; Clifford Chance | Allen & Overy advised Czech Gas Networks Investments on its successful issuance and placement of EUR 600 million and CZK 6.75 billion notes with investors on international capital markets. Clifford Chance reportedly advised joint book-runners Citigroup Global Markets Europe AG, Societe Generale, UniCredit Bank AG, Ceska Sporitelna, a.s., Ceskoslovenska Obchodni Banka, a. s., and Komercni Banka, a.s., as well as trustee Citicorp Trustee Company Limited and the London branch of Citibank, which acted as the paying agent, transfer agent, and the agent bank. | EUR855million | Czech Republic | Here |
5-Aug | Bird & Bird | Bird & Bird advised KB SmartSolutions on its strategic entry into Upvest. | N/A | Czech Republic | Here |
6-Aug | Eversheds Sutherland; HKDW Legal | Eversheds Sutherland advised Expandia on the sale of the Hamburg Business Center office complex in Pilsen, in the Czech Republic. HKDW Legal advised the buyer. | N/A | Czech Republic | Here |
12-Aug | Heuking Kuhn Luer Wojtek; Kocian Solc Balastik | Kocian Solc Balastik and Germany's Heuking Kuhn Luer Wojtek advised China-based Inner Mongolia Mengtai on the acquisition of the Czech part of the Apt group. | N/A | Czech Republic | Here |
19-Aug | Kinstellar | Kinstellar advised Genesis Growth Equity Fund I on its acquisition of R2B2, an advertising company in the Czech Republic. | N/A | Czech Republic | Here |
2-Sep | BPV Braun Partners | BPV Braun Partners advised ECO Finance Group s.r.o on establishing a joint venture with the Roman Catholic Archdiocese of Olomouc. | N/A | Czech Republic | Here |
10-Sep | Havel & Partners | Havel & Partners assisted eMan a.s. with the listing of its CZK 45 million securities on the Prague Stock Exchange's START exchange. | CZK45million | Czech Republic | Here |
14-Sep | DLA Piper; NKL Legal | DLA Piper's Prague office advised Russia's Trust Union Fund on its acquisition of the Kovosvit machine tool manufacturer from Industry Innovation. NKL Legal advised the sellers on the deal. | N/A | Czech Republic | Here |
14-Sep | Dentons; Weinhold Legal | Weinhold Legal advised Etarea Invenium on its acquisition of Pactio DB from the Pactio Invest group. Dentons advised the seller. | N/A | Czech Republic | |
17-Sep | Baker McKenzie; Pierstone | Pierstone advised the Prague-based Socialbakers social media marketing company on the sale of its global business to U.S.-based customer engagement company Astute. Baker McKenzie advised Astute on the deal. | N/A | Czech Republic | Here |
22-Sep | Kocian Solc Balastik | Kocian Solc Balastik helped the Walteran Company obtain a license from the Czech National Bank to operate an investment company. | N/A | Czech Republic | Here |
22-Sep | Kocian Solc Balastik | KSB advised the WY Group on its acquisition of Hosting90 System and Hosting Zdarma in the Czech Republic. | N/A | Czech Republic | Here |
24-Sep | Baker Mckenzie; JSK; Urban & Hejduk | Baker McKenzie's Prague office advised Worldline SA/NV on its acquisition of a 53% of stake in Gopay. JSK and Urban & Hejduk advised the seller on the deal. | N/A | Czech Republic | Here |
24-Sep | Kinstellar; White & Case | Kinstellar advised Czech investment group Portiva and Micronix on its acquisition of the Central Kladno shopping center in the Czech town of Kladno from Crestyl. White & Case advised Crestyl on the deal. | CZK2billion | Czech Republic | Here |
25-Sep | Dentons | Dentons advised CPI Property Group on a successful tender offer and the issue of EUR 525 million 4.875% undated subordinated notes callable in November 2026. | EUR525million | Czech Republic | Here |
28-Sep | DLA Piper | DLA Piper advised Inven Capital on an unspecified investment in Sweden's Eliq AB. | N/A | Czech Republic | Here |
5-Oct | Kocian Solc Balastik | KSB advised Eligo on its acquisition of the Czech branch of Euroserum. | N/A | Czech Republic | Here |
6-Oct | Kocian Solc Balastik | KSB advised the Pilsen Public Transport Corporation on awarding a public contract to renovate the Slovany tram depot in the Czech city of Plzen. | CZK1.7billion | Czech Republic | Here |
9-Oct | Havel & Partners | Havel & Partners advised Prazska Teplarenska on the spin-off of its assets into five successor companies. | N/A | Czech Republic | Here |
9-Oct | BPV Braun Partners; Schoenherr; Setina Komendova & Partners | Schoenherr advised KB SmartSolutions on the acquisition of an almost 25% stake in Platebni Instituce Roger from Echilon Capital. BPV Braun Partners advised Echilon Capital on the transaction, and Setina, Komendova & Partners advised Platebni Instituce Roger's CEO Adam Soukal and CTO Tomas Slobodnik. | N/A | Czech Republic | Here |
9-Oct | Havel & Partners | Havel & Partners helped Czech software supplier eMan list its shares on the Start stock exchange. | CZK45million | Czech Republic | Here |
13-Oct | JSK; Noerr | JSK advised Poland's R22 Group on its acquisition by auction of a 100% stake in ProfiSMS s.r.o. and its two Czech fully-owned subsidiaries, Axima SMS Services s.r.o. and SMSbrana s.r.o., from Net Brokers Holding. Noerr represented the sellers. | N/A | Czech Republic | Here |
13-Oct | Havel & Partners | Havel & Partners advised on the sale of the Czech special purpose vehicle that owns Prime Timesheet to Icelandic IT company Tempo Ehf. | N/A | Czech Republic | Here |
13-Oct | Havel & Partners | Havel & Partners advised Genesis Capital Growth on the acquisition of a 100% stake in Home Care Promedica, a home healthcare and social services provider in the Czech Republic. | N/A | Czech Republic | Here |
19-Oct | Clifford Chance; Wilsons | Clifford Chance advised Generali Real Estate on the acquisition of the IBC office building in Prague from Mint Investments. Wilsons advised Mint Investments. | N/A | Czech Republic | Here |
19-Oct | Havel & Partners; Noerr | Noerr advised Bilfinger SE on the sale of Bilfinger Industrial Services Czech s.r.o., Bilfinger Euromont a.s., and Bilfinger Slovensko s.r.o to funds advised by Deutsche Invest Mittelstand. Havel & Partners advised the buyers on the deal. | N/A | Czech Republic | Here |
19-Oct | Kocian Solc Balastik | Kocian Solc Balastik advised J&T Banka on project financing to the Julius Meinl Living Group for the development of an apartment hotel on Senovazne Namesti in Prague. | EUR27million | Czech Republic | Here |
20-Oct | JSK | JSK advised shareholders Petr Janu, Jan Zvonik, Ladislav Partl, and Jiri Trcka on the sale of TKZ Polna, spol. s r.o. to the Rose Investments Group. | N/A | Czech Republic | Here |
20-Oct | Davis Polk; Novalia; Schoenherr | Schoenherr and Davis Polk advised Germany's Celonis on its acquisition of Integromat and its subsidiaries in the Czech Republic. Novalia advised the selling shareholders on the deal. | N/A | Czech Republic | Here |
22-Oct | Havel & Partners | Havel & Partners, working pro bono, helped the Plant-for-the-Planet organization establish its presence in the Czech Republic. | N/A | Czech Republic | Here |
22-Oct | KLB Legal | KLB Legal advised Pilulka Lekarny on its initial public offering on the Start market of the Prague Stock Exchange. Wood & Company Financial Services served as the arranger on the offering, which was valued at CZK 250 million. | CZK250Million | Czech Republic | Here |
27-Oct | Dentons; Skils | Dentons advised international energy group Sev.en Energy on the acquisition of the Pocerady power plant from CEZ. Skils advised CEZ on the transaction. | N/A | Czech Republic | Here |
27-Oct | Clifford Chance | Clifford Chance advised AOC on its acquisition of the unsaturated polyester resin manufacturing operations of Spolchemie. | N/A | Czech Republic | Here |
27-Oct | Eversheds Sutherland; Kastner Gravelle | Eversheds Sutherland advised construction management software provider Procore Technologies on Czech aspects of its acquisition of Esticom, a cloud-based estimating and take-off solution provider and preconstruction technology provider. Kastner Gravelle advised on US Law. | N/A | Czech Republic | |
30-Oct | PRK Partners | PRK Partners advised International Campus Group on the completion of a first-of-its-kind student campus in Prague. | N/A | Czech Republic | |
31-Oct | Havel & Partners; White Case | Havel & Partners advised Innogy SE on the sale of a 50.04% stake in innogy Grid Holding a.s, a Czech gas distribution network, to RWE. White & Case advised the buyer. | N/A | Czech Republic | |
3-Nov | Bird & Bird | Bird & Bird assisted KB SmartSolutions on an unspecified investment into the fintech company Lemonero, made through the acquisition of shares in its parent company, MonkeyData. | N/A | Czech Republic | Here |
3-Nov | Allen & Overy; White & Case | Allen & Overy advised Ceska Zbrojovka Group on its initial public offering and the listing of its shares on the Prime Market of the Prague Stock Exchange. White & Case advised joint global coordinators and joint bookrunners Ceska Sporitelna, Komercni Banka, and Societe Generale. | CZK812million | Czech Republic | Here |
5-Nov | Kocian Solc Balastik | KSB successfully represented Czech railway carrier Leo Express in a complaint against competitor Ceske Drahy filed with the European Commision. | N/A | Czech Republic | Here |
5-Nov | Kinstellar | Kinstellar helped Nexen Tire Europe lease a 12,000-square-meter warehouse in CTPark Zatec, about 80 kilometers northwest of Prague, from CTP Bohemia North. | N/A | Czech Republic | Here |
5-Nov | Clifford Chance | Clifford Chance advised sole lead manager J&T Banka and arranger J&T IB Capital Markets on Energo-Pro Green Finance's issuance of bonds valued at CZK 530 million. | CZK530million | Czech Republic | Here |
6-Nov | Kocian Solc Balastik; PRK Partners | PRK Partners advised Euroserum on the sale of its international operations to Eligo. Kocian Solc Balastik reportedly advised Eligo. | N/A | Czech Republic | Here |
11-Nov | Kinstellar | Kinstellar advised Veolia on its acquisition of Prazska Teplarenska from EP Energy, a subsidiary of the EPH Group. | N/A | Czech Republic | Here |
11-Nov | Baroch Sobota; Schoenherr | The Czech office of Schoenherr advised the Auto Palace Group, a Czech subsidiary of the Dutch AutoBinck Group, on the acquisition of car dealerships in Prague and Karlovy Vary from CarPoint Karlovy Vary s.r.o., which was advised by Baroch Sobota. | EUR6million | Czech Republic | Here |
16-Nov | Forlex; Kinstellar | Kinstellar advised Kemp Technologies on its acquisition of Czech Republic-based Flowmon. Forlex advised the unidentified sellers. | N/A | Czech Republic | Here |
25-Nov | Glatzova & Co; HKR | Glatzova & Co advised Bike Fun Nederland B.V. on the sale of Bike Fun International, a company based in the Czech city of Koprivnice, to ConsilTech. HKR advised ConsilTech on the deal. | N/A | Czech Republic | Here |
27-Nov | BPV Braun Partners; Svec Rychterova | BPV Braun Partners advised Generali Investments CEE, an investment company acting on behalf of the Generali Real Estate Fund, on the acquisition of an early 20th-century building in Prague from Ferd s.r.o. Ferd was advised by the Svec Rychterova law firm. | N/A | Czech Republic | Here |
27-Nov | Kocian Solc Balastik | Kocian Solc Balastik advised ING Bank Slaski on financing to an unidentified borrower for the acquisition of two LET Aircraft Industries L-410 UVP E-20 aircrafts. | N/A | Czech Republic | Here |
1-Dec | Kocian Solc Balastik; Noerr | Noerr assisted ALSO Holding AG on its acquisition of Daquas, a Cloud Solution Provider for Microsoft from the Droege Group. The seller was advised by Kocian Solc Balastik. | N/A | Czech Republic | |
9-Dec | Allen & Overy; Dentons | Dentons advised the CPI Property Group on its new five-year term EUR 700 million revolving credit facility with Banco Santander, Barclays, Credit Suisse, Goldman Sachs, HSBC, J.P. Morgan, Komercni Banka, Raiffeisen Bank AG, UniCredit, and Bank of China. Allen & Overy's London office advised the banks on the deal. | EUR700million | Czech Republic | Here |
15-Dec | Dentons | Dentons successfully represented Veolia Energie CR in a dispute with Czech tax authorities regarding interest from illegal gift tax. | N/A | Czech Republic | Here |
16-Dec | Glatzova & Co.; Rutland Partners | Glatzova & Co. advised Raiffeisenbank on its provision of a CZK 215 million loan to BesTen. Rutland Partners advised the borrower on the deal. | CZK215million | Czech Republic | Here |
16-Dec | Glatzova & Co. | Glatzova & Co. helped Smartlook.com obtain a CZK 81 million Series A investment from Dutch investment company Airbridge Equity Partners and other unidentified investors. | CZK81million | Czech Republic | Here |
23-Dec | Glatzova & Co | Glatzova & Co advised Reflex Capital on the sale of its stake in Brno startup Webnode to the Belgian company Team.Blue. | N/A | Czech Republic | Here |
23-Dec | Kocian Solc Balastik | Kocian Solc Balastik advised Arete Invest's real-estate fund on the EUR 113 million sale of a portfolio of 11 logistics and industrial parks in the Czech Republic and Slovakia to Australia-based fund Cromwell. | EUR113million | Czech Republic | Here |
23-Dec | PRK Partners | PRK Partners and NautaDutilh advised CD Cargo on the successful acquisition of a CZK 3.43 billion loan from the European Investment Bank. | CZK3.43billion | Czech Republic | |
24-Dec | AK Evan; Clifford Chance | Clifford Chance advised Corporate Finance House Group on a joint acquisition with Ceskomoravska Nemovitostni of the Churchill Square office from Penta Real Estate. AK Evan advised Penta Real Estate on the deal. | CZK4billion | Czech Republic | Here |
28-Dec | Clifford Chance; Kocian Solc Balastik | Kocian Solc Balastik advised J&T Banka on its CZK 2.1 billion acquisition of Rustonka Development II, which owns the Rustonka office building in Karlin, Prague. Clifford Chance advised the sellers on the deal. | CZK2.1billion | Czech Republic | Here |
29-Dec | Bpv Braun Partners; Kinstellar | BPV Braun Partners advised Immofinanz on the acquisition of retail parks in the Czech town of Litvinov and the Horni Mecholupy neighborhood of Prague from Mitiska Reim. Kinstellar advised Mitiska Reim on the deal. | N/A | Czech Republic | Here |
29-Dec | Novalia; Schoenherr | Schoenherr advised Beijer Ref AG on the acquisition of a majority stake in Czech Sinclair Global Group s.r.o. from private individuals Ivo Nespor, Vladimir Pakosta, and Zdenek Cizek. Novalia advised the sellers on the deal. | N/A | Czech Republic | Here |
31-Dec | PRK Partners | PRK Partners advised a syndicate of ING Bank, Ceska Sporitelna, and Hypo Noe Gruppe Bank AG on project financing for an underground gas storage facility in Damborice, in the Czech Republic. | N/A | Czech Republic | |
22-Oct | Noerr; Vyskocil Kroslak & Partneri | Noerr advised Kuka AG, a manufacturer of industrial robots, production machines, and systems, on the closure and disposal of a manufacturing plant in Northern Bohemia. Vyskocil Kroslak & Partneri advised the buyer. | N/A | Czech Republic | |
2-Jan | Lakatos, Koves & Partners; Szecskay | LKT assisted Cad Studio s.r.o., the Czech distributor of Autodesk, on its purchase of the Autodesk distribution business of Varinex. The sellers were advised by Szecskay. | EUR2million | Czech Republic; Hungary | |
17-Sep | CMS; Schoenherr | Schoenherr advised Covivio on its lease of the Carlo IV hotel in Prague and the New York Palace and New York Residence hotels in Budapest to the NH Hotel Group. CMS advised the NH Hotel Group on the deal. | N/A | Czech Republic; Hungary | Here |
22-Sep | Castren & Snellman; DLK Legal; Havel & Partners; Kinstellar; Osborne Clarke; Sorainen | DLK Legal in Poland and Kinstellar in Hungary and the Czech Republic advised Infosys on its acquisition of GuideVision. Osborne Clarke, Sorainen, and Castren & Snellman also advised Infosys on the deal. Havel & Partners served as GuideVision's advisor in the Czech Republic. | EUR30million | Czech Republic; Hungary; Poland | Here |
19-Mar | Allen & Overy; Greenberg Traurig; Kinstellar; Kirkland & Ellis | Greenberg Traurig provided Polish advice to GLP on its acquisition of Goodman Group's Central and Eastern Europe logistics portfolio. Kirkland & Ellis served as global legal counsel to GLP, while Kinstellar provided local legal advice with respect to Czech, Slovak, and Hungarian aspects of the transaction. Allen & Overy advised the Goodman Group on the deal. | EUR1billion | Czech Republic; Hungary; Poland; Slovakia | Here |
16-Dec | Jadek & Pensa; Schoenherr | Schoenher advised EP Logistics International, a.s on its acquisition of a 49% stake in SZ-Tovorni Promet d.o.o., a Slovenia-based company engaged in providing rail cargo services, and Fersped AD Skopje, a Macedonia-based company from Slovenian Railways Ltd. Fersped AD was advised by Jadek & Pensa. | EUR60million | Czech Republic; North Macedonia; Slovenia | |
9-Sep | DLA Piper; Havel & Partners; Schoenherr | Schoenherr advised Twisto Payments a.s. on the increase of share capital by existing and new investors. DLA Piper and Havel & Partners advised the investors - ZIP Co Ltd and Elevator Ventures. | EUR6.1million | Czech Republic; Poland | |
22-Dec | Havel & Partners; Schoenherr | Havel & Partners advised Elevator Ventures Beteligungs GmbH on its acquisition of a 2.34% stake in Twisto Payments a.s. Schoenherr advised the seller. | N/A | Czech Republic; Poland | |
28-Dec | Baker Mckenzie | Baker McKenzie advised Energeticky a Prumyslovy Holding on the sale of 38.946% of the shares and Braindour Development Limited on the sale of 61.029% of the shares in Polish coal mine Przedsiebiorstwo Gornicze Silesia to Bumech. | N/A | Czech Republic; Poland | Here |
14-Feb | CMS; Dentons; Leges | Lawyers from CMS in Ukraine and Poland joined the firm's multi-national team advising the EBRD on the acquisition of a stake in Uzbek food retailer Korzinka. Uzbek law firm Leges reportedly advised the EBRD as well, while Dentons advised the sellers. | USD40million | Czech Republic; Poland; Russia; Ukraine | Here |
14-Feb | Clifford Chance; Go2Law; Schoenherr | Schoenherr and Hugh Owen of Go2Law advised UNIQA on its acquisition of AXA subsidiaries in the Czech Republic, Poland, and Slovakia. Clifford Chance advised AXA on the transaction. | EUR1billion | Czech Republic; Poland; Slovakia | Here |
26-Aug | Garrigues; Studnicki, Pleszka, Cwiakalski, Gorski | Studnicki, Pleszka, Cwiakalski, Gorski advised the Oriens Bijou Group on the sale of the network to the Tous group. Garrigues advised Tous on the deal. | N/A | Czech Republic; Poland; Slovakia | Here |
1-Jan | Bondoc & Asociatii | Bondoc si Asociatii assisted the Generali Group on the restructuring of its pension funds management activities in Romania. | N/A | Czech Republic; Romania | |
20-Feb | Dentons; Rodl & Partner | Dentons advised GeoPost / DPDgroup on the acquisition of Czech and Slovak parcel delivery operations of Germany's Geis logistics group. The Geis group was advised by Rodl & Partner. | N/A | Czech Republic; Slovakia | Here |
28-Feb | Badokh; CMS; Schoenherr | Schoenherr advised Kommunalkredit Austria AG on financing provided to Enery Development for its acquisition of six 21 MW solar power plants in the Czech Republic and two 4 MW solar power plants in the Slovak Republic from Czech fund Green Horizon Renewables. CMS advised Enery and Badokh advised Green Horizon Renewables. | N/A | Czech Republic; Slovakia | Here |
31-Mar | White & Case | White & Case advised TPG Capital on a development loan for unidentified industrial premises to "serve as multi-purpose facilities for warehousing, administration, and trade and science and technology." | N/A | Czech Republic; Slovakia | Here |
22-Jun | Havel & Partners; Majernik & Mihalikova | Majernik & Mihalikova advised two shareholders of NG Aviation, a start-up developing a platform for digitizing aeronautical data, on the sale of some of their shares. Havel & Partners advised the unidentified buyer. | N/A | Czech Republic; Slovakia | |
3-Jul | Allen & Overy; Clifford Chance | Clifford Chance advised Vseobecna Uverova Banka a.s., the Slovak subsidiary of Intesa Sanpaolo, on the update of its EUR 5 billion covered bond program and another syndicated EUR 500 million issuance via the Luxembourg Stock Exchange. Allen & Overy advised joint lead managers Banca IMI S.p.A., Commerzbank Aktiengesellschaft, Danske Bank A/S, Erste Group Bank AG, and Landesbank Baden-Wuerttemberg. | N/A | Czech Republic; Slovakia | Here |
6-Aug | Blockchain Legal; Majernik & Mihalikova | Majernik & Mihalikova, as Slovak law advisor, and Blockchain Legal, as Czech law advisor, assisted Citadelo and its shareholders on a number of transfers of the shareholdings in the Slovak and Czech entity among the founders and to Swizterland's Artmotion, which became a majority shareholder in both entities. | N/A | Czech Republic; Slovakia | |
18-Nov | Hamala Kluch Viglasky; Havel & Partners | Havel & Partners advised Austria's Innofreight Consulting & Logistics on the formation of a joint venture with Slovakia's Budamar Logistics. Hamala Kluch Viglasky advised Budamar Logistics on the deal. | N/A | Czech Republic; Slovakia | Here |
3-Jan | PWC Legal | PWC Legal advised DncOne OU, managed by Estonian entrepreneur Ullar Jaaksoo, on its acquisition of iD Susteemide OU. | N/A | Estonia | Here |
17-Jan | Tark | Tark successfully represented Solaris Bus & Coach in a dispute over the procurement of gas buses for Tallinna Linnatranspordi. | N/A | Estonia | Here |
17-Jan | Sorainen | Sorainen successfully represented Eesti Kontsert, a state-owned philharmonic foundation, in a dispute against claimants United Capital and Brutus Inkasso. | EUR28296 | Estonia | Here |
20-Jan | Leadell (Pilv) | The Leadell Pilv firm successfully defended businessman Alexander Kofkin in the Harju County Court. | N/A | Estonia | Here |
21-Jan | Sorainen; Triniti | Triniti advised ANMKinnisvara, K.E.D.S, and Faroc on the sale of Birger to Finland's Fincumet Group, which was advised by Sorainen. | N/A | Estonia | Here |
22-Jan | Cobalt; Sorainen | Cobalt advised the European Investment Bank on a EUR 50 million venture debt facility to Bolt, the Estonian developer of a ride-hailing app. The borrowers were advised by Sorainen on the financing. | EUR50million | Estonia | Here |
27-Jan | Cobalt; Ellex (Raidla); Nove | Cobalt advised and represented AS Ragn-Sells in a complex insurance dispute with Seesam Insurance regarding the fires in Ragn-Sells' MBT-plant in Tallinn. Nove and Ellex Raidla advised Seesam. | N/A | Estonia | |
28-Jan | TGS Baltic | TGS Baltic advised real estate company KEK Arendus OU, a member of the Rondam Group, on its acquisition of an office building in the Tallinn city center from Danske Bank A/S and on its conclusion of a lease contract with the current user of the building. | N/A | Estonia | Here |
29-Jan | Cobalt | Cobalt advised AS PRFoods, a fish farming and production company listed on the Tallinn Stock Exchange, on a private placement of secured notes. | EUR9.1million | Estonia | Here |
31-Jan | Ellex (Raidla); PwC Legal | PwC Legal Estonia advised DncOne OU on its acquisition of iD Susteemide OU. Ellex Raidla advised the sellers. | N/A | Estonia | Here |
31-Jan | Sorainen | Sorainen advised the Fincumet Group on the acquisition of a 60% stake of Estonia's Birger, a producer of hooklift containers and related steel constructions, from owner and CEO Aleksei Manniste. | N/A | Estonia | Here |
5-Feb | HPP Attorneys; Pohla & Hallmagi | Estonia's Pohla & Hallmagi advised Wraight Invest on its acquisition of the remaining 54% of Hobby Hall Group OU from fellow shareholders SGN Group Oy and Four P&P Consulting Oy. Finland's HPP Attorneys advised the Finnish sellers on the deal. | N/A | Estonia | Here |
5-Feb | Cobalt | Cobalt advised Poco Holding on the sale of banking-as-a-service provider PocoSys to the Opera Group. Opera also signed an agreement to acquire PocoSys's sister company, EU-licensed payment institution Pocopay. | N/A | Estonia | Here |
12-Feb | Glikman Alvin Levin | Glikman Alvin Levin advised Deca Games OU on its merger with Deca Live Operations GmbH. | N/A | Estonia | Here |
19-Feb | Cobalt | Cobalt advised Change Ventures on its EUR 500,000 investment in Estonian educational startup 99math. | EUR500000 | Estonia | Here |
21-Feb | Cobalt | Gide advised B&B Hotels Polska on a cooperation agreement with Covivio and on the sale and leaseback of three hotels. Covivio was advised by Wardynski & Partners. | N/A | Estonia | Here |
28-Feb | Njord | Njord represented RedDigital OU on its entrance into a sponsorship deal with Watford FC for the Sportsbet.io brand. Australia's KKI law firm advised Watford. | GBP6million | Estonia | |
5-Mar | Cobalt | Cobalt advised Laurus S.a.r.l. on the sale of the Valge Maja office building in Tallinn to LHV pension funds. | N/A | Estonia | Here |
5-Mar | Cobalt | Cobalt successfully helped Nuctech Warsaw Company Limited Sp. z o.o. win a public procurement procedure to sell the Tallinn Airport two baggage-scanning devices. | N/A | Estonia | Here |
17-Mar | Cobalt | Cobalt advised Luminor Bank on its inaugural issue of covered bonds, with an aggregate nominal value of EUR 500 million. | EUR500million | Estonia | Here |
27-Mar | Pohla & Hallmagi | Pohla & Hallmagi advised the Hobby Hall Group, operating under the Hansapost brand, on an agreement to manufacture and provide personal protective equipment to the seven clinics of the North Estonia Medical Center. | N/A | Estonia | |
27-Mar | Cobalt | Cobalt advised SA KredEx on conducting a public procurement in 2020 for the development of the Estonian start-up business ecosystem and start-up business development programs. | N/A | Estonia | |
30-Mar | Cobalt | Cobalt successfully represented Estonia's largest waste handler Ragn-Sells AS in a dispute regarding the public procurement of a waste removal concession organized by the Vinni municipality in northern Estonia. | N/A | Estonia | Here |
2-Apr | Cobalt | Cobalt advised fashion brand house AS Baltika on reorganization proceedings. | N/A | Estonia | Here |
7-Apr | Borenius; Cobalt; Ellex (Raidla); Ideal Advokatfirma | Cobalt and Ideal advised Denmark's DA Agravis Machinery Holding A/S on acquiring the remaining 55% of the shares in AS Konekesko Eesti, a company selling agricultural machinery. Borenius and Ellex Raidla advised the seller. | N/A | Estonia | |
16-Apr | PwC Legal | PwC Legal successfully represented Guardtime in a public procurement dispute before the Public Procurement Review Committee and Tallinn Administrative Court, which allowed Guardtime to enter into a public procurement agreement with NATO to develop an automated planning and control platform for the NATO Cyber Range. | N/A | Estonia | Here |
16-Apr | Sorainen | Sorainen advised Tenova India Private, an international innovative solutions provider for metals and mining, in an asset recovery process. | N/A | Estonia | Here |
17-Apr | Cobalt; Eversheds Sutherland | Eversheds Sutherland Ots & Co Managing Partner Maivi Ots been designated the reorganization adviser for proceedings related to AS Tallinna Moekombinaat, the owner and administrator of the T1 Mall of Tallinn, advised by Cobalt. | N/A | Estonia | Here |
20-Apr | Derling Primus; TGS Baltic | TGS Baltic advised AS Framm on the acquisition of AS Lasbet Tootmine from AS Lasbet. Derling Primus advised AS Lasbet on the deal. | N/A | Estonia | Here |
20-Apr | Sorainen | Sorainen advised Auth0 on its acquisition of Apility.io. | N/A | Estonia | Here |
21-Apr | Cobalt | Cobalt advised Steel Import Finland Oy, a metal products wholesaler, on the acquisition of Estonia's Osauhing FinEst Metallid. | N/A | Estonia | Here |
23-Apr | Cobalt; Ideal Advokatfirma; Njord; Trust OY | Cobalt, working alongside Ideal Advokatfirma, advised Baltic Agro Machinery OU on the sale of John Deere's agricultural and horticultural machinery business in Estonia to Wihuri OU. Njord and Trust OY advised the buyer. | N/A | Estonia | Here |
24-Apr | Cobalt | Cobalt's Tallinn office successfully represented Starbucks Corporation in a dispute involving a local entrepreneur's attempt to register a confusingly similar trademark. | N/A | Estonia | Here |
30-Apr | Njord; Wistrand | Njord consulted Vereeni Investments Ltd on its investment in Sweden's Flax Innovations. Flax was advised by the Swedish firm Wistrand. | EUR0.5million | Estonia | |
1-May | Glimstedt; TGS Baltic | TGS Baltic advised SIA Mailigen on the sale of its mailing business to Estonian company Pipedrive. Glimstedt advised the buyer. | N/A | Estonia | |
7-May | Fort | Fort Legal advised AS Selver, a subsidiary of Tallinna Kaubamaja Grupp AS, on its acquisition of a 100% shareholding in retailer ABC Supermarkets AS. | N/A | Estonia | Here |
7-May | Sorainen | Sorainen represented Tallinna Linnatranspordi Aktsiaselts, a company fully owned by the City of Tallinn, in its purchase of compressed gas for natural gas-powered buses. | N/A | Estonia | Here |
18-May | Cobalt | Cobalt advised Change Ventures on its investment in fintech startup askRobin. | N/A | Estonia | Here |
18-May | Sorainen | Sorainen assisted SeAH Changwon Integrated Special Steel Corporation with an asset recovery process. | N/A | Estonia | Here |
26-May | Ellex (Raidla) | Ellex Raidla advised NGO Back to Work on testing one of the world's first digital immunity passports - an application that enables users to securely share data when a person taken a COVID-19 virus test or an antibody test. | N/A | Estonia | Here |
26-May | Cobalt | Cobalt advised AS LHV Pank, an Estonian credit institution with shares are listed on the Tallinn Stock Exchange, on the establishment of its EUR 1 billion Covered Bond Program. | EUR1billion | Estonia | Here |
29-May | Sorainen | Sorainen successfully represented the Polybius Foundation, which had conducted an initial coin offering, in a dispute involving one of the buyers, Maksim Velitsko, who was attempting to force a reversal of his token purchase. | N/A | Estonia | Here |
29-May | Cederwalls; Cobalt; Krogerus; Njord; Roschier | Njord, working with lead advisor Roschier in Sweden and Krogerus as advisor in Finland, advised the Sveafastigheter Fersen AB real estate fund on a cross-border reinvestment transaction. Cederwalls and Cobalt advised Nordea Bank. | N/A | Estonia | |
29-May | Njord | Njord advised CoinField Ventures OU on the start of Sologenic IEO -- the first project to utilize the XRP Ledger for tokenizing stocks and ETFs. | USD2Million | Estonia | |
2-Jun | Cobalt | Cobalt advised Nordea Bank Abp on amendments to a EUR 280 million loan agreement with AS Tallink Grupp, an Estonian shipping company, that was signed in 2016. | EUR280million | Estonia | Here |
3-Jun | Sorainen | Sorainen advised transportation platform Bolt on a EUR 100 million investment from London-based investment firm Naya Capital Management. | EUR100million | Estonia | Here |
3-Jun | Ellex (Raidla) | Ellex Raidla advised the European Investment Bank on a EUR 25 million loan to the North Estonia Medical Centre. | EUR25million | Estonia | Here |
8-Jun | TGS Baltic | TGS Baltic advised Iron Mountain Inc. on the applicable time limits for the preservation of documents and obligations regarding the submission of documents to public authorities. | N/A | Estonia | Here |
15-Jun | Sorainen | Sorainen Estonia advised Communications & Power Industries on the acquisition of SATCOM Technologies, the antenna systems business of General Dynamics. | N/A | Estonia | Here |
15-Jun | Fort | Fort's Estonia office advised AS LHV Pank, a subsidiary of AS LHV Group, on its acquisition of Danske Bank's business unit operating the Estonian corporate and public sector credits, which at the end of April amounted to approximately EUR 312 million. | EUR312million | Estonia | Here |
15-Jun | Sorainen | Sorainen advised the Estonian technology company Milrem Robotics on raising EUR 5.5 million from a number of prominent Estonian investors. | EUR5.5million | Estonia | Here |
16-Jun | Sorainen | Sorainen advised Livonia Partners on the sale of a majority stake in Thermory, a producer of thermally modified wood and sauna materials, to Estonian capital-based UG Investeeringud, which as a result transforms from a minority to a majority shareholder. | N/A | Estonia | Here |
16-Jun | Cobalt; Schjodt | Cobalt advised the Algeco Group on its acquisition of Wexus Group AS from Norvestor Equity AS. Norway's Schjodt law firm advised the sellers. | N/A | Estonia | Here |
16-Jun | Sorainen | Sorainen advised the Fortum Corporation on the acquisition by subsidiary Fortum Heat Estonia of the remaining 40% in district heating and cooling group Fortum Tartu from Giga. | N/A | Estonia | Here |
16-Jun | TGS Baltic | Acting on behalf of Erial Ehitus OU, TGS Baltic successfully persuaded the Supreme Court of Estonia to overrule lower courts' rulings that the company's name could not be registered because the word "construction" ("ehitus," in Estonian) in its name was protected as a trademark. | N/A | Estonia | Here |
19-Jun | Triniti | Triniti successfully persuaded the Tallinn Circuit Court of Appeal to uphold the judgment of the District Court in a dispute between Estonian individual Katrin Lust and prominent chiropractor and entertainer Allan Gary Oolo involving an episode of the Estonian TV show Kuuuurija. | N/A | Estonia | Here |
23-Jun | Sorainen | Sorainen advised EIB on financing a project related to the modernization of tracks and signaling and traffic control systems of Estonian Railways. | EUR95million | Estonia | Here |
26-Jun | Cobalt | Cobalt advised AS Baltika on reorganization proceedings. | N/A | Estonia | Here |
26-Jun | Cobalt | Cobalt helped Luminor Bank request the termination of the reorganization proceedings of dumpling producer Uvic. | EUR9million | Estonia | Here |
26-Jun | Cobalt; Ellex (Raidla); Sorainen | Cobalt advised Fortumo and Ellex Raidla advised the company's founders and shareholders Mobi Solutions, Rain Rannu and Veljo Otsason on the sale of Fortumo to global mobile payments platform Boku. Sorainen advised Boku on the deal. | USD45million | Estonia | Here |
1-Jul | Cobalt; Hedman Partners | Cobalt advised Change Ventures on a seed investment into Planet42. Hedman Partners reportedly advised Planet42. | EUR2.2million | Estonia | Here |
8-Jul | Cobalt | Cobalt advised Berlin-based early-stage investor Project A on its investment in Estonian start-up Pactum, an AI-based platform that enables global companies to automate personalized commercial negotiations on a massive scale. | N/A | Estonia | Here |
8-Jul | Cobalt; Fort | Cobalt advised Laurus - a joint venture of Partners Group and Northern Horizon Capital - on the sale of the building housing SEB's head office in Tallinn to East Capital Real Estate IV. Fort Legal advised the buyer on the transaction. | EUR45.75million | Estonia | Here |
21-Jul | Cobalt | Cobalt helped the Estonian Ministry of Economic Affairs and Communications obtain authorization to provide State aid from the European Commission. | EUR20million | Estonia | Here |
23-Jul | Ellex (Raidla) | Ellex Raidla successfully represented Enefit Green in a dispute over competition clearance the company received for its 2018 merger with Nelja Energia AS. | N/A | Estonia | Here |
3-Aug | Sorainen | Sorainen advised Montonio on its generation of EUR 500,000 from both Estonian and international investors. | EUR500000 | Estonia | Here |
5-Aug | Cobalt | Cobalt advised Estonia-based real estate development and management company Capfield OU on a EUR 85 million financing it received from Luminor. | EUR85million | Estonia | Here |
7-Aug | Cobalt | Cobalt advised Estonia's Helmes on its acquisition of all shares of software development company T2T from Latvia's Tet. | N/A | Estonia | Here |
11-Aug | Cobalt | Cobalt advised the Rubylight technology investment fund on its participation in Tandem's Series A round of financing, which also included investors Brighteye Ventures, Trind Ventures, and GPS Ventures. | USD5.7million | Estonia | Here |
2-Sep | PwC Legal | PwC Legal advised GuardTime on its entrance into a partnership with the Estonian Ministry of Interior's IT and Development Centre. | N/A | Estonia | Here |
2-Sep | TGS Baltic | TGS Baltic successfully represented the interests of Kuu HUBB Oy in a dispute in the Arbitration Court of the Estonian Chamber of Commerce and Industry. | N/A | Estonia | Here |
7-Sep | Eversheds Sutherland; Sorainen | Eversheds Sutherland in Estonia advised UP Invest on its EUR 65 million acquisition of Forum Cinemas from AMC. Sorainen advised AMC on the deal. | EUR65million | Estonia | Here |
14-Sep | Sorainen | Sorainen advised Sunly City on the implementation of a new business model for electricity consumers, and on developing and drafting customer contracts for solar energy solutions. | N/A | Estonia | Here |
2-Oct | Nove | The Nove Law Firm successfully represented the Political Party Financing Supervision Committee in a dispute with the Center Party of Estonia. | EUR40387 | Estonia | Here |
6-Oct | Ellex (Raidla) | Ellex Raidla advised the LHV Group on the public offering of its EUR 25 million subordinated bonds. | EUR85.3million | Estonia | Here |
12-Oct | Cobalt | Cobalt successfully represented textile solutions supplier Protex Balti AS in a dispute with Amigtex, the vendor of Optitex software. | N/A | Estonia | Here |
13-Oct | Cobalt | Cobalt successfully represented Protex Balti in a dispute with Amigtex. | N/A | Estonia | Here |
28-Oct | Eversheds Sutherland; Sorainen | Sorainen advised Splunk Inc., a US-based global provider of the Data-to-Everything Platform, on the acquisition of Estonian tech startup Plumbr. Eversheds Sutherland advised Plumbr's selling shareholders on the deal. | N/A | Estonia | Here |
2-Nov | Sorainen | Sorainen advised Metsagrupp on its entrance into a joint venture with Sunly Land. | N/A | Estonia | Here |
3-Nov | Sorainen | Sorainen advised Northern Horizon Capital on a secondary public offering that raised EUR 7.2 million and a listing of new units of the Baltic Horizon Fund on Nasdaq Tallinn and Nasdaq Stockholm stock exchanges. | EUR7.2million | Estonia | Here |
6-Nov | Ellex (Raidla) | Ellex Raidla helped Skeleton Technologies Group raise EUR 41.3 million in a funding round from a group of investors, including EIT InnoEnergy, FirstFloor Capital, MM Group, and Harju Elekter. | EUR41.3million | Estonia | Here |
10-Nov | Cobalt; Hedman Partners | Cobalt advised Passion Capital on its USD 1.4 million seed-round investment into Warren.io. Hedman Partners advised Warren.io on the deal. | USD1.4million | Estonia | Here |
13-Nov | Cobalt | Cobalt advised Ambient Sound Investments and other shareholders on the sale of InBio to Semetron. | N/A | Estonia | Here |
16-Nov | Cobalt | The Riga office of Cobalt helped 3Commas raise USD 3 million in series A funding from Alameda Research. | USD3million | Estonia | Here |
16-Nov | Cobalt; Ellex (Raidla) | Cobalt advised Estonian energy group Alexela on its receipt of a EUR 37 million loan from Sihtasutus KredEx, a financing institution established by the Estonian Ministry of Economic Affairs and Communications. Ellex Raidla advised KredEx on the deal. | EUR37Million | Estonia | Here |
17-Nov | Avance Attorneys; Cobalt | The Tallinn office of Cobalt advised French private investment house Ardian on its acquisition of 100% of Nevel Oy from Vapo Oy. Vapo was advised by Finland's Avance Attorneys. | N/A | Estonia | Here |
18-Nov | Sorainen | Sorainen advised Fenestra on its acquisition of Kuopion Rakennuskonttori, a Finnish provider of window installation services. | N/A | Estonia | Here |
18-Nov | Hedman Partners | Hedman Partners become Solaride's legal advisor on its project to build a solar-powered car in Estonia. | N/A | Estonia | Here |
23-Nov | Cobalt; Pohla & Hallmagi | Pohla & Hallmagi advised F&A Kinnisvara, a member of the Favorite Group, on its acquisition of a residential development project near Tallinn. The unidentified sellers were advised by Cobalt. | N/A | Estonia | Here |
23-Nov | Cobalt | Cobalt successfully represented Helmes, an international custom software developer, in disputes regarding the public procurement process for "Development and Maintenance Services for Collection App Software" organized by Estonia's Information Technology Center of the Ministry of Finance. | EUR1.25million | Estonia | Here |
23-Nov | Ellex (Raidla); Pohla & Hallmagi | Pohla & Hallmagi helped Verston Ehitus acquire Estonia's state-owned road maintenance company AS Eesti Teed at public auction. Ellex Raidla advised the Ministry of Economic Affairs and Communications on the auction. | EUR19.7million | Estonia | Here |
23-Nov | Njord; TGS Baltic | Njord assisted Kirkcong Property OU with the development and maintenance of the Heathmont Group's new office building in Tallinn. TGS Baltic advised the seller. | EUR8million | Estonia | |
25-Nov | Hedman Partners; Morgan Lewis & Bockius; TGS Baltic | TGS Baltic advised Gan Limited on the acquisition of the Coolbet online gaming platform from the Vincent Group. Hedman Partners and Morgan, Lewis & Bockius advised the Vincent Group on the deal. | N/A | Estonia | Here |
27-Nov | Fort | Fort Legal advised LHV Pension Funds on the acquisition of three stock office-type commercial buildings in Juri in the Rae municipality of Estonia. | N/A | Estonia | Here |
27-Nov | Pohla & Hallmagi | Pohla & Hallmagi advised Arca Varahaldus on its EUR 6.2 million sale of property in Tallinn to EfTEN Real Estate Fund III AS subsidiary EfTEN SPV19 OU. | N/A | Estonia | Here |
27-Nov | Ellex (Raidla) | Ellex Raidla advised the 1more Project on its EUR 21 million acquisition of two buildings in Tallinn from Hammerhead. | EUR21million | Estonia | Here |
27-Nov | Njord | Njord assisted Imepilt AS with its IPO on the First North growth market, with LHV Bank. | EUR1.5million | Estonia | |
1-Dec | Sorainen | Sorainen successfully represented Estonian meat producer Atria in its dispute with the Estonian Veterinary and Food Board. | N/A | Estonia | Here |
2-Dec | Sorainen | Sorainen and Sweden's Vinge Law Firm advised Swedish industrial group Hexatronic on the acquisition of Estonia-based Baltronic and Canada-based Toronics. | N/A | Estonia | Here |
11-Dec | Cobalt | Cobalt advised AS Ekspress Grup, on the conclusion of an employee share option program and the setting up of a new option program. | N/A | Estonia | Here |
15-Dec | Ellex (Raidla); Sorainen | Sorainen's Tallinn office advised Sunly Land on the issuance of its EUR 14 million bonds, which are to be invested in by Estonia's LHV pension funds. Ellex Raidla advised LHV on the deal. | EUR14million | Estonia | Here |
16-Dec | Cobalt | Cobalt advised the shareholders of MCF Group Estonia OU on the sale of the company to Greenergy Data Centers. | N/A | Estonia | Here |
16-Dec | Pohla & Hallmagi | Pohla & Hallmagi helped the E-Governance Academy establish a joint venture with Japan's Mitsubishi UFJ Research and Consulting. | N/A | Estonia | Here |
16-Dec | Cobalt; Ellex (Raidla) | Cobalt advised Estonian fintech company Modularbank on raising EUR 4 million of late seed funding. The round was led by Karma Ventures and BlackFin Capital Partners, with additional support from Plug and Play Ventures, Siena Capital, and angel investor Ott Kaukver. Ellex advised Karma Ventures and BlackFin Capital Partners on the transaction. | EUR4million | Estonia | Here |
18-Dec | Ellex (Raidla) | Ellec Raidla helped the Council of the University of Tartu establish UniTartu Ventures - a way to direct the intellectual property created by UT researchers to research-and-technology-intensive companies. | N/A | Estonia | Here |
18-Dec | Pohla & Hallmagi | Pohla & Hallmagi advised Estonian vehicle rental company Mobire Group OU on the sale of a 53% stake to Inbank. | N/A | Estonia | Here |
18-Dec | Njord | Njord assisted Japanese corporation MBK Co., Ltd., and its Estonian subsidiary Estonian Japan Trading Company AS, on its structural establishment and IPO on the First North growth market. | N/A | Estonia | |
21-Dec | Cobalt | Cobalt successfully represented the Havas marketing communications agency in a dispute with Alfa-Omega Communications regarding the results of a public procurement process organized by Enterprise Estonia. | N/A | Estonia | Here |
21-Dec | Orrick; Sorainen | Sorainen advised Estonian mobility platform Bolt on a EUR 150 million funding round. The investment was led by D1 Capital Partners, with the participation of Darsana Capital Partners. Orrick advised Darsana Capital Partners on its participation in the funding round. | EUR150million | Estonia | Here |
23-Dec | PwC Legal | PWC Legal's successfully represented the Estonian Authors' Society, the Estonian Association of the Phonogram Producers, the Estonian Performers' Association, the Estonian Association of Audiovisual Authors, the Estonian Composers' Union, the Association of Estonian Professional Musicians, the Estonian Directors' and Dramaturgs' Union, the Estonian Association of Stage Performers, and the Association of Professional Actors of Estonia in a dispute regarding compensation for the reproduction of original works. | EUR3.5million | Estonia | Here |
24-Dec | Sorainen | Sorainen advised the Saunum Group on the initial public offering of its shares and their admission to trading on the First North alternative market, operated by Nasdaq Tallinn. | EUR500000 | Estonia | Here |
28-Dec | TGS Baltic | TGS Baltic advised Nikolai Russakov, the owner of the AS Kroodi Terminal fuel terminal and MK Kamion OU fuel wholesaler, on the sale of the two companies to Terminal Oil OU. | N/A | Estonia | Here |
29-Dec | Ellex (Raidla); PwC Legal | Ellex Raidla advised the BaltCap Growth Fund on an acquisition of a majority stake in Tradehouse from founders Avo and Angela Kivimaa. PwC Legal advised the sellers. | N/A | Estonia | Here |
29-Dec | DLA Piper; Sorainen | Sorainen, working with DLA Piper, advised paints producer PPG on a voluntary recommended public cash tender offer for all the shares in Tikkurila, a Nordic paint and coatings company. | N/A | Estonia | Here |
29-Dec | TGS Baltic | TGS Baltic successfully represented Pipes Building OU in a dispute against Narva Vesi AS, a company belonging to the Estonian city of Narva. | N/A | Estonia | Here |
29-Dec | Nove | Nove advised Elering on its agreement with Siemens Energy for the construction of three synchronous compensators for frequency stability of the electricity systems at the 330 kilovolt substations in the Estonian communities of Viru, Pussi, and Kiisa. | EUR83.5million | Estonia | Here |
2-Jan | Allen & Overy; Sorainen | Kocian Solc Balastik; PRK Partners | N/A | Estonia; Latvia | Here |
19-Feb | Cobalt | Cobalt assisted Viessmann with the restructuring of its refrigeration systems business in Latvia. | N/A | Estonia; Latvia | Here |
22-Apr | Cobalt | Cobalt advised Lauma Fabrics, a textile manufacturer in the Baltics and Europe, on the delivery of COVID-19 personal protective equipment to Estonia and Latvia. | N/A | Estonia; Latvia | Here |
1-Dec | TGS Baltic | TGS Baltic advised SIA BRC on its reorganization and cross-boarder merger with OU Balti Realiseerimiskeskus and BR Merger OU. | N/A | Estonia; Latvia | |
11-Dec | Cobalt | Cobalt advised US biotech company Biogen on launching its business in Latvia and Estonia. | N/A | Estonia; Latvia | Here |
18-Feb | Cobalt | Cobalt advised SEB life insurance entities in Estonia, Latvia, and Lithuania on a cross-border merger in the Baltics. | N/A | Estonia; Latvia; Lithuania | Here |
11-Jun | Sorainen | Sorainen successfully defended the interests of racing organizer NASCAR in disputes involving the registration of the company's trademark in Lithuania, Latvia, and Estonia. | N/A | Estonia; Latvia; Lithuania | Here |
3-Jul | Sorainen | Sorainen advised the Vienna Insurance Group on consolidating the businesses of its group non-life insurance companies Compensa and Seesam in Lithuania, Latvia, and Estonia. | N/A | Estonia; Latvia; Lithuania | Here |
22-Jul | Ellex (Klavins); Ellex (Raidla); Ellex (Valiunas); Latham & Watkins; Sorainen | Sorainen advised the Bite Group on a EUR 700 million bond issuance and refinancing. Latham & Watkins and Ellex reportedly advised initial bond purchasers and mandated lead arrangers Citigroup Global Markets Limited, Deutsche Bank AG, London Branch, ING Bank N.V., London Branch, and UniCredit Bank AG. | EUR700million | Estonia; Latvia; Lithuania | Here |
9-Oct | Sorainen | Sorainen advised Infracapital and AMP Capital on the sale of their combined ownership interest in Adven, a provider of clean energy solutions across the Nordics and Baltics, to unnamed institutional investors. | N/A | Estonia; Latvia; Lithuania | Here |
17-Nov | Arendt & Medernach | Arendt & Medernach helped INVL Asset Management launch the INVL Sustainable Timberland and Farmland Fund II. | N/A | Estonia; Latvia; Lithuania | Here |
30-Jul | Deloitte Legal; Kaevando & Partnerid | Lawyers from Deloitte Legal's Lithuanian and Estonian offices advised Lonas UAB, a manufacturer of mattresses and beds, on its acquisition of Estonia's Dreamland Home OU, a retailer and wholesaler of bedroom products, from ITIS Holding OU. Kaevando & Partnerid advised the sellers on the deal. | N/A | Estonia; Lithuania | Here |
13-Nov | Njord | Njord advised GVP Invest Estonia OU on its development of a second Hilton hotel in Estonia. | EUR100million | Estonia; Lithuania | |
22-Dec | Bryan Cave Leighton Paisner; TGS Baltic | TGS Baltic and Bryan Cave Leighton Paisner advised the Mubadala Investment Company on investment in MEL Science - part of the latter's USD 14 million Series B funding round. | N/A | Estonia; Russia | Here |
11-Feb | Zepos & Yannopoulos | Zepos & Yannopoulos advised Greek real estate developer ZOIA on the acquisition of 16 real estate properties in Athens from various unnamed sellers. | N/A | Greece | Here |
20-Feb | Koutalidis | Koutalidis advised Alpha Bank S.A. on matters of Greek Law related to its issuance of a EUR 500 million Tier 2 subordinated bond. | EUR500million | Greece | Here |
24-Mar | Karatzas & Partners; White & Case; Zepos & Yannopoulos | White & Case and Zepos & Yannopoulos advised Centerbridge Partners and Elliott Advisors UK Limited on the acquisition of a EUR 900 million portfolio of secured non-performing small business lending and SME loans from the National Bank of Greece. Karatzas & Partners advised the NBG on the deal. | EUR900million | Greece | Here |
25-May | Drakopoulos; Koutalidis; Your Legal Partners | Koutalidis advised Aktor Concessions S.A. on its successful bid to own, use, administer, operate, and exploit the Marina of Alimos. The concession, which is good for 40 years, was granted by the Hellenic Asset Development Fund. The HADF was advised by Dracopoulos & Vassalakis and Your Legal Partners. | EUR177million | Greece | Here |
28-May | Alexiou-Kosmopoulos; Dracopoulos & Vassalakis; Your Legal Partners | Dracopoulos & Vassalakis, Your Legal Partners, and Alexiou-Kosmopoulos have been appointed as legal advisors to the Hellenic Republic Asset Development Fund on the privatization of regional ports of Alexandroupolis, Heraklion, Igoumenitsa, and Volos through the sale of majority stakes in the state-owned port operating companies. | N/A | Greece | Here |
17-Jun | Karatzas & Partners; Zepos & Yannopoulos | Zepos & Yannopoulos advised Bain Capital Credit LP on the acquisition of a portfolio of approximately 2,800 primarily secured non-performing corporate loans, originated or otherwise owned by National Bank of Greece S.A. Karatzas & Partners advised the NBG | EUR1.6billion | Greece | Here |
17-Jun | Karatzas & Partners; Zepos & Yannopoulos | Zepos & Yannopoulos advised arrangers Alantra Corporate Portfolio Advisors, Mediobanca - Banca di Credito Finanziario, and security trustee, cash manager, and account bank Citibank London branch on the EUR 7.5 billion multi-asset NPE securitization of Eurobank Ergasias. Karatzas & Partners advised Eurobank Ergasias. | EUR7.5billion | Greece | Here |
22-Jun | Karatzas & Partners; Karatzas & Partners; Koutalidis | Koutalidis advised Eurobank Ergasias S.A. on the sale of 80% stake of subsidiary Eurobank Financial Planning Services to DoValue S.p.A. DoValue was advised by Karatzas & Partners. | EUR11.3billion | Greece | Here |
15-Jul | Drakopoulos | Drakopoulos advised Brook Lane Special Situations Fund on the reverse (downstream) merger of two of the group's entities. | EUR26.5million | Greece | |
21-Jul | Bahas Gramatidis & Partners | Bahas, Gramatidis & Partners is advising Coffee Berry and Hans & Gretal on the creation of their corporate structures and the structuring of franchise agreements for Greece and abroad. | N/A | Greece | Here |
22-Jul | Koutalidis | Koutalidis advised investment fund Southbridge Europe Mezzanine and the founders of Skroutz S.A. on the sale of a minority stake in Skroutz S.A. to CVC Capital Partners. | N/A | Greece | Here |
28-Jul | Koutalidis | Koutalidis advised mandated lead arrangers Bank of Greece, Alpha Bank, Eurobank, Piraeus Bank, and Euroxx Securities, and issuance advisors Eurobank and Piraeus Bank, on Lamda Development S.A.'s issuance of a EUR 320 million bond and it admission to trading on the Athens Exchange. | EUR320million | Greece | Here |
31-Jul | Norton Rose Fulbright | Norton Rose Fulbright advised Admie, the owner and operator of the Greek electricity transmission grid, on the concession for the Crete-Attica high-voltage direct current interconnection project, which was granted to Admie's subsidiary Ariadne Interconnection. | N/A | Greece | Here |
11-Aug | Zepos & Yannopoulos | Zepos & Yannopoulos advised Pancreta Bank on its transformation from a cooperative bank into a "societe anonyme." | N/A | Greece | Here |
19-Oct | Bernitsas; Hogan Lovells; Kyriakides Georgopoulos; Norton Rose Fulbright; White & Case; Zepos & Yannopoulos | White & Case and Zepos & Yannopoulos advised the EIF and the EBRD on securitization of automotive leases originated by Olympic Commercial and Tourist Enterprises S.A., a car leasing company in Greece that is the master franchisee of the Avis Budget Group. Avis was advised by Norton Rose Fulbright andKyriakides Georgopoulos, while Hogan Lovells and M&P Bernitsas advised lead manager and sole arranger Citi and co-lead manager Piraeus Bank. | EUR130million | Greece | Here |
4-Nov | Drakopoulos | Drakopoulos represented Evangelos Tsoumpas before the Court of Appeal in a banking and insurance law matter against Ergon Insurance and the Agricultural Bank of Greece. | EUR5.3million | Greece | |
18-Nov | iLaw; Zepos & Yannopoulos | Zepos & Yannopoulos assisted Globecast France throughout an international open tender procedure for the provision of global signal transmission by the Hellenic Broadcasting Organization | N/A | Greece | Here |
26-Nov | Zepos & Yannopoulos | Zepos & Yannopoulos advised the Generali Group on the acquisition of an office building in Athens from Panterra. | N/A | Greece | Here |
1-Dec | KLC | Greece's KLC Law Firm advised National Energy Holdings in its first investment in Greece - the acquisition and construction of five solar parks to be constructed in Central Greece, with a total capacity of 24 MW, for which it secured financing of EUR 22 million from Piraeus Bank. | N/A | Greece | Here |
18-Dec | Drakopoulos; Grafanaki & Associates; Karatzas & Partners | Drakopoulos advised Brook Lane Special Situations Fund on the acquisition of Sorosos Real Estate, a company owning an office building in a prime location, in parallel with the acquisition from Bain Capital of a bond loan issued by the company. Karatzas & Partners advised Bain Capital. Grafanaki & Associates advised the sellers. | EUR11.5million | Greece | |
22-Dec | KLC | Greece's KLC Law Firm assisted Italy's Edison on the sale of its Edison Exploration & Production subsidiary to Greece's Energean. | N/A | Greece | Here |
24-Dec | Anagnostopoulos | Anagnostopoulos successfully defended former Siemens executive Dionysios Dendrinos in a criminal case regarding alleged bribery and money laundering. | N/A | Greece | Here |
30-Dec | Drakopoulos; Grafanaki & Associates | Drakopoulos advised Brook Lane Special Situations Fund on its acquisition of aÊ commercial real estate asset that is leased out to Antenna TV and the Regional Administration of Northern Athens. Grafanaki & Associates advised the sellers. | EUR5.87million | Greece | |
30-Dec | Bernitsas | Bernitsas Law advised CVC on the acquisition of a controlling stake in Vivartia Holdings SA. | N/A | Greece | Here |
30-Apr | Bird & Bird; Kyriakides Georgopoulos | Bird & Bird and Kyriakides Georgopoulos advised Bank Gospodarstwa Krajowego on a credit agreement annex. | EUR15.5million | Greece; Poland | Here |
10-Nov | Allen & Overy; Linklaters | Allen & Overy advised Lamda Hellix on its sale to Digital Realty's Interxion subsidiary. Linklaters advised the buyer on the deal. | N/A | Greece; Poland | Here |
1-Jan | Filip & Company; Freshfields | Filip & Company advised the National Bank of Greece S.A. on the sale of its participation in the share capital of Banca Romaneasca S.A to Eximbank, a state-owned bank in Romania. Freshfields advised on English Law. | N/A | Greece; Romania | |
1-Jan | Barna es Tarsai; Szecskay | Szecskay represented Hendrix Genetics BV, a multi-species animal breeding, genetics, and technology company, on the sale of the turkey breeder Greleger Kft. and its four poultry farms to Nagisz Zrt. Barna es Tarsai advised Nagisz. | N/A | Hungary | |
13-Jan | DLA Piper; EY Law | DLA Piper advised Bernard Matthews/Boparan Group on the sale of Hungarian poultry producer SaGa to the Hungarian Master Goods Group. Vamosi-Nagy Ernst & Young Law Office represented the buyer. | N/A | Hungary | |
24-Jan | Katona Gyorgy Law Office; Lakatos, Koves & Partners | Lakatos, Koves & Partners advised Soulbrain on the acquisition of a development site from the state-owned National Industrial Park Management and Development Company. The sellers were advised by the Katona Gyorgy Law Office. | N/A | Hungary | Here |
28-Jan | BLS; Schoenherr | Hungary's BLS Law Firm advised LP Portfolio on its issuance of HUF bonds under the Bond Funding for Growth Scheme announced by the Central Bank of Hungary. Schoenherr advised the arranger, OTP Bank. | N/A | Hungary | Here |
28-Jan | Jalsovszky | Jalsovszky advised both parties on the sale by Magyar Posta Takarek Ingatlan Befektetesi Alap of the Buda Business Center Office Building to an unnamed real estate fund. | N/A | Hungary | Here |
29-Jan | Jalsovszky; Lovasz | Jalsovszky advised Magyar Posta Takarek Ingatlan Befektetesi Alap on its sale of a retail portfolio, consisting of warehouses in the Hungarian communities of Ajka, Albertirsa, Dunaujvarosm, and Oroshaz. The unidentified buyers were advised by Lovasz. | N/A | Hungary | Here |
30-Jan | CMS | CMS Hungary advised India-based manufacturing company SRF Limited on an EUR 70 million credit facility. | EUR70million | Hungary | Here |
31-Jan | HBK Parters; Jalsovszky; Noerr | Noerr advised ElringKlinger AG on the sale of the Heliport Industrial Park in Kecskemet, Hungary, to a consortium led by Infogroup and including an equity fund owned by the Municipality of Kecskemet. Jalsovszky advised Infogroup and HBK Partners advised Kecskemet on the deal. | N/A | Hungary | Here |
31-Jan | DLA Piper | DLA Piper advised sole shareholder Equilor Alapkezelo Zrt. on the merger of two real estate SPVs, V177 Kft. and Vaci 175 Irodahaz Kft., into one: V Development Kft. | N/A | Hungary | |
5-Feb | DLA Piper | DLA Piper advised the Hungarian Fund Management Company on the acquisition of Forgacs Intezet, a company focusing on the provision of reproductive health services and obstetric and outpatient care. The unidentified seller was advised by Solo Practitioner Forgacs Vince. | N/A | Hungary | Here |
5-Feb | DLA Piper | DLA Piper advised the Hungarian Fund Management Company on its acquisition of shares in Sterilitas and Varandos. Solo practitioner Istvan Devai advised the unidentified seller on the deal. | N/A | Hungary | Here |
5-Feb | Gattai Minoli Agostinelli & Partners; Schoenherr | Schoenherr advised Sonepar S.A. on its acquisition of Hungarian electricity and telecommunication equipment distributor Marchiol Kft. from Marchiol S.p.a., which was advised by Gattai Minoli Agostinelli & Partners. | N/A | Hungary | |
6-Feb | Dentons; DLA Piper | DLA Piper advised Optima Investment Co Ltd on the sale of the Reno Udvar real estate project in Hungary to the Chi Fu Group. Dentons advised the buyer on the deal. | EUR60million | Hungary | Here |
5-Mar | Noerr; P+P Pollath & Partners | The Budapest office of Noerr joined the firm's multi-jurisdictional team advising Saxonia Systems Holding GmbH on its sale of Saxonia Systems AG to Carl Zeiss AG. P+P Pollath & Partners advised the buyers on the deal. | N/A | Hungary | Here |
1-Apr | Lakatos, Koves & Partners | LKT advised joint lead managers Citigroup Global Markets Limited, ING Bank N.V., and J.P. Morgan Securities plc on Hungary's EUR 2 billion note issuance, which consisted of (i) EUR 1 billion in aggregate principal amount of 1.125 percent notes due 2026 and (ii) EUR 1 billion in aggregate principal amount of 1.625 percent notes. | EUR2billion | Hungary | |
3-Apr | Dentons; Jalsovszky; Noerr; Szabo Kelemen & Partners Andersen Attorneys | Noerr advised the Doktor24 Group on a series of transactions, including raising private equity capital and acquiring two healthcare companies in Hungary: Svabhegyi Gyermekgyogyintezet and Kastelypark Klinika. Dentons advised the co-investors on the funding, the Jalsovszky Law Firm advised the sellers of Svabhegyi Gyermekgyogyintezet, and Szabo Kelemen & Partners advised the sellers of Kastelypark Klinika. | N/A | Hungary | Here |
14-Apr | Jalsovszky; Oppenheim | Jalsovszky advised Szkaliczki Holding on the sale of Szkaliczki & Partners Plastic Processing Ltd to Nefab AB, a Swedish company that offers multi-material packaging solutions and logistics services. Oppenheim advised Nefab. | N/A | Hungary | Here |
1-May | Clifford Chance; Lakatos, Koves & Partners; Zsolt Szita Law Firm | LKT advised the managers in connection with the EUR 1.5 billion 1.75 percent green notes issued by the Government Debt Management Agency Private Company Limited by Shares of Hungary. Clifford Chance London was English law counsel to the joint lead managers and Zsolt Szita Law Firm advised AKK (The Hungarian Asset Management Agency). | EUR1.5billion | Hungary | |
19-May | Allen & Overy; Gardos Mosonyi Tomori | Balazs Sahin-Toth, Counsel in the Budapest office of Allen & Overy, working pro bonoin conjunction with Peter Gardor from Hungary's Gardos Mosonyi Tomori Law Firm and Hungarian solo practitioners Adel Kegye and Eleonora Hernadi, persuaded the Hungarian Supreme Court to uphold a lower court's decision that the Hungarian segregation of Roma students between 2003 and 2017 provided a lower level of education. | N/A | Hungary | Here |
28-May | D'Ornano Partners; RSM Legal Szucs & Partners | D'Ornano Partners advised the Hungarian subsidiary of the Ruget group on the transfer of assets and the sale of real estate to Hungary's Ferzol Group. RSM Legal Szucs & Partners advised Ferzol on the deal. | N/A | Hungary | Here |
29-May | DLA Piper | DLA Piper advised Waterlogic on the acquisition of the water machine portfolio of Vedoital Kft. Solo practitioner Lenard Raffai advised Vedoital. | N/A | Hungary | |
1-Jun | Deloitte Legal; Lakatos, Koves & Partners | LKT represented LGI Denmark Aps, a subsidiary of BHJ Group, regarding the acquisition of 75% of the shares of Organo-Pet Kft. a local pet food manufacturer, from Szilagyi Family Holding. Deloitte Legal represented the seller. | N/A | Hungary | |
1-Jun | Clifford Chance; DLA Piper; Lakatos, Koves & Partners | LKT acted as Hungarian counsel of arrangers Erste Bank, J.P. Morgan, and ING Bank on Magyar Fejlesztesi Bank's EUR 750 million 5-year Eurobond issuance on the main board of the London Stock Exchange. Clifford Chance advised the arrangers on English law and DLA Piper advised the issuer. | EUR750million | Hungary | |
24-Jun | Cerha Hempel; Lakatos, Koves & Partners | Lakatos Koves & Partners advised the Dubai-based Al Habtoor Group on the sale of Budapest's Rumbach Center to GalCap Europe, a real estate asset and investment manager operating in Austria and Central Europe. Cerha Hempel advised GalCap Europe on the deal. | N/A | Hungary | Here |
10-Jul | Cerha Hempel | Cerha Hempel's Budapest office helped set-up a new company - Cetin Hungary - by way of a de-merger from Telenor Hungary. | N/A | Hungary | Here |
30-Jul | DLA Piper; Kinstellar | Kinstellar advised the Hungarian State on a greenfield investment in a helicopter spare parts manufacturing plant to be established in Hungary by Airbus Helicopters and the Hungarian state-owned NLP Nemzeti Legiipari Projekt Kft. DLA Piper advised Airbus Helicopters SAS. | N/A | Hungary | Here |
31-Jul | Allen & Overy; Erdos | Katona | Erdos | Katona advised Cordia International Zrt. on its HUF 36 billion bond issuance, made pursuant to the Bond Funding for Growth Program of the Hungarian National Bank. Allen & Overy advised lead arranger Raiffeisen Bank. | HUF36billion | Hungary | Here |
31-Jul | Csetneki Law Firm; Noerr | Noerr advised Szallas.hu on the acquisition of Hungarian travel agency group maiUtazas Group. The Csetneki Law Firm advised the sellers. | EUR5million | Hungary | |
12-Aug | Erdos | Katona; Kinstellar | Erdos | Katona advised Hell Energy on its refinancing of an existing loan with four unidentified Hungarian banks. Kinstellar reportedly advised the banks. | N/A | Hungary | Here |
13-Aug | CMS; Noerr | Noerr's Budapest office advised UniCredit Bank on financing provided to GTC for the development of the Pillar office building in Budapest. CMS reportedly advised GTC on the deal. | N/A | Hungary | Here |
19-Aug | Noerr | Noerr's Budapest office advised K&H Bank on financing provided to Wing Zrt. for development of the Gizella Loft office building. | N/A | Hungary | Here |
26-Aug | Szecskay | Szecskay advised Dutch company Gilder Investment B.V. on its cross-border merger into a Hungarian member of the group, United Informatics Kft. | EUR7.2million | Hungary | |
9-Sep | Kapolyi | The Kapolyi law firm advised Duna House, a property brokerage group in Central and Eastern Europe, on its participation in the National Bank of Hungary's Growth Bond Program. | N/A | Hungary | Here |
14-Sep | CMS; Lakatos, Koves & Partners | LKT advised Vodafone on its negotiations with Futureal regarding the lease of their Budapest headquarters. CMS advised Futureal. | N/A | Hungary | |
23-Sep | Hogan Lovells; Kinstellar; Noerr | Noerr advised UniCredit on financing to South Korean real estate investment trust JR AMC for its acquisition of the Nordic Light Trio office building in Budapest from Skanska. Partos & Noblet - the Budapest office of Hogan Lovells - advised JR AMC on both the financing and the underlying acquisition, while Kinstellar advised Skanska. | N/A | Hungary | Here |
23-Sep | CMS; Garrigues; Linklaters; Szecskay | Szecskay and Garrigues advised Spanish renewable energy and gas supplier Audax Renovables SA on its acquisition of Hungarian power retailer Eker from E.ON Hungaria Zrt., the local subsidiary of E.ON SE. CMS and Linklaters advised the seller. | N/A | Hungary | |
15-Oct | Bird & Bird; DLA Piper | DLA Piper advised Granit Bank Zrt and its majority shareholder, EPM Tanacsado Kft, in connection with an investment by way of a capital increase in Granit Bank Zrt by KMVA, a state-owned venture capital fund and a parri passu co-investor, whereby the investors aquired a significant stake in Garnitbank Zrt. Bird & Bird advised KMVA. | HUF4.29billion | Hungary | |
20-Oct | DLA Piper | DLA Piper advised the shareholders of Csillag Csemege Kft. on the sale of the NAGISZ Group to PortFolion Green Fund. | N/A | Hungary | |
27-Oct | Deloitte Legal; Lakatos, Koves & Partners; White & Case | White & Case and Lakatos Koves and Partners have advised Mid Europa Partners on the sale of 24% of the issued share capital of Waberer's International Nyrt to Trevelin Holding Zrt, the Hungarian-based member of Indotek Group. Deloitte Legal advised Trevelin Holding on the deal. | N/A | Hungary | Here |
30-Oct | Clifford Chance; Lakatos, Koves & Partners; Radvanyi Law Firm | LKT and Clifford Chance advised Fitesa Hungary on its acquisition of the Tredegar Corporation's Personal Care Films business. The Radvanyi Law Firm advised the seller. | N/A | Hungary | |
4-Nov | Humpfner Law Firm; Kinstellar | Kinstellar advised Resolution Property on its acquisition of an approximately 37,200 square meter office portfolio in Budapest from Hungarian fund manager Adventum Zrt. Adventum was advised by the Humpfner Law Firm | N/A | Hungary | |
6-Nov | Kertesz and Partners; Lakatos, Koves & Partners | Lakatos Koves & Partners advised Innobyte on the sale of a majority stake in the company and its Innoware subsidiary to IT company 4iG. Following the approval of the Hungarian Competition Office, the transaction closed in October. Kertesz and Partners advised 4iG on the deal. | N/A | Hungary | Here |
16-Nov | Schoenherr | Schoenherr advised Doosan on its EUR 210 million investment in its copper foil production base in Tatabanya, Hungary, for the construction of another factory on the location. | EUR210million | Hungary | Here |
1-Dec | Ashurst; Kinstellar | Kinstellar advised mandated lead arranger and facility and security agent Bank of China on a USD 75 million financing for the construction of a 100 MWp photovoltaic power plant in Kaposvar, Hungary. Ashurst acted as English counsel to Bank of China on the transaction. | USD75million | Hungary | |
9-Dec | Ban, S. Szabo & Partners | Ban, S. Szabo & Partners advised Vodafone on the demerger of Vantage Towers in Hungary. | N/A | Hungary | Here |
17-Dec | Cerha Hempel; Schoenherr | Schoenherr advised Masped Group on the sale of its railway cargo business to the GATX corporation. Cerha Hempel advised the buyer. | N/A | Hungary | |
22-Dec | Deloitte Legal; Schoenherr | Schoenherr advised Switzerland-based technology company ABB on the sale of its plant in Ozd, Hungary, to wellness equipment producer Wellis, which was advised by Deloitte Legal. | N/A | Hungary | Here |
22-Dec | DLA Piper; HBK Partners; Kinstellar; Nagy es Kiss Law Office; Szabo Kelemen & Partners Andersen Attorneys | DLA Piper advised the owners of the Budapest Bank Group, the KB Bank Group, and the Takarekbank Group on their establishment of the Hungarian Bankholding Ltd. financial holding company. Rothschild & Co was the lead transactional advisor on the transaction. Kinstellar and HBK Partners represented MKB Bank, Nagy es Kiss Law Office represented Budapest Bank, and Szabo Kelemen & Partners Andersen Attorneys represented Takarekbank. | EUR2billion | Hungary | Here |
29-Dec | Noerr | Noerr advised Chinese lithium batteries precision parts manufacturer Shenzhen Kedali Industry on a EUR 40 million investment in a new battery production plant in Godollo, Hungary. | EUR40million | Hungary | Here |
31-Dec | Schoenherr | Schoenherr helped BOE, a subsidiary of Austria's List Group, conclude a management agreement to manage the Vorosmarty Garage in Budapest. | N/A | Hungary | Here |
1-May | Noerr | Noerr represented CIG Pannonia in connection with the sale of its non-life insurance portfolio to Aegon. | N/A | Hungary, Poland | |
3-Dec | Clifford Chance; Germus & Tarsai; SSW Pragmatic Solutions; Wolf Theiss | SSW Pragmatic Solutions advised the Cotta Group on its acquisition of seven production properties in southwest Poland, and advised Cotta's sister company, Kanizsa Trend, on its acquisition of a production plant in Hungary, from Standard Properties. Germus & Tarsai, Wolf Theiss, and Clifford Chance advised the seller on the deal. | N/A | Hungary; Poland | Here |
29-Dec | Noerr | Noerr advised Switzerland's Evoco AG on the acquisition of six subsidiaries of Gesco AG from Wuppertal. | N/A | Hungary; Russia | Here |
11-Dec | Allen & Overy; Dentons; Fenwick & West; White & Case | Allen & Overy advised Cisco on the acquisition of Slovakia-based Sli.do technology company from Instando, Anton Zajac, Hewor Property Management, and Kenneth Patrick Ryan. Dentons advised the sellers on the deal with White & Case advising several shareholders. Fenwick & West advised Cisco on US matters. | N/A | Hungary; Slovakia | Here |
24-Jan | Dentons; White & Case | Dentons advised Enlight Renewable Energy on the construction and EUR 115 million financing of the 105 MW Selac wind farm in Kosovo. The EBRD provided EUR 57 million of the total amount, with Erste Group Bank and NLB Bank providing the remaining EUR 58 million, and with coverage provided by the German export credit agency Euler Hermes. The lenders were advised by White & Case. | EUR115million | Kosovo | Here |
1-Jan | TGS Baltic | TGS Baltic advised SIA Olaine Logistic Park on its merger with SIA Olaines Logistics. | N/A | Latvia | |
15-Jan | Cobalt; Sorainen | Cobalt advised Workday, Inc. on Latvian issues related to its cross-border acquisition of online procurement platform Scout RFP. The sellers were advised by Sorainen. | N/A | Latvia | Here |
17-Jan | Cobalt | Cobalt is representing UAB Niklita in a dispute related to a procurement process organized by the Prisons Administration of the Ministry of Justice of Latvia involving the supply of catering services to prisoners. | N/A | Latvia | Here |
6-Feb | Sorainen | Sorainen advised the Kaamos Group on its acquisition of one-sixth of the shares in Sunly Land. | N/A | Latvia | Here |
20-Feb | Deloitte Legal; Ellex (Klavins); Sorainen; TGS Baltic | Ellex Klavins advised SIA Verus Praedium on its sale of 14.45 hectares of land to SIA Riga Retail Park for the development of a new Saga shopping center. Riga Retail Park was advised by Sorainen. | N/A | Latvia | Here |
4-Mar | Ellex (Valiunas); Nestor Nestor Diculescu Kingston Petersen; Penkov Markov & Partners; Uria Menendez; Wardynski & Partners | Ellex Valiunas advised Edenred SA on its acquisition of a 60% stake in Lithuania's EBV Finance. The acquisition also included EBV Finance subsidiaries in Bulgaria, Poland, Romania, Spain, and Estonia. Penkov Markov & Partners advised Edenred in Bulgaria, as did Wardynski & Partners in Poland, Nestor Nestor Diculescu Kingston Petersen in Romania, and Uria Menendez in Spain. | N/A | Latvia | Here |
5-Mar | Cobalt | Cobalt successfully represented AS PNB Banka before Latvia's Constitutional Court in a case involving the fee calculation for credit institutions for financing the Financial and Capital Market Commission's operations. | N/A | Latvia | Here |
6-Mar | Deloitte Legal; TGS Baltic | TGS Baltic and Deloitte Legal advised CVI Dom Maklerski on financing provided to SIA Riga Retail Park for the purposes of co-financing its acquisition of real property as well as the construction and development of the Saga Lifestyle and Shopping Centre in Stopini, a suburb of Riga, by Baltic real estate developer VPH UAB. | EUR11million | Latvia | Here |
12-Mar | Ellex (Klavins); TGS Baltic | TGS Baltic advised Cooperatieve Rabobank U.A. on its refinancing of Latvian fishing company SIA Batterfisa's existing liabilities and working capital needs. Batterfisa was advised by Ellex Klavins. | EUR10million | Latvia | Here |
9-Apr | Sorainen | Sorainen advised the Biolars chemical factory on starting the manufacturing of disinfectants in its Latvian production plants. | N/A | Latvia | Here |
14-Apr | Allen & Overy; Cobalt | Cobalt advised joint lead managers Barclays, J.P. Morgan, and Societe Generale on the Republic of Latvia's EUR 550 million Eurobond issuance. Allen & Overy advised the Republic of Latvia on the issuance. | EUR550million | Latvia | Here |
20-Apr | TGS Baltic | TGS Baltic advised SIA Saules Aptieka on an agreement with People's Republic of China regarding the supply of surgical face masks to Latvia. | N/A | Latvia | Here |
22-Apr | Cobalt | Cobalt advised APX on an unspecified pre-seed investment into Marine Digital. | N/A | Latvia | Here |
23-Apr | Cobalt | The Latvian office of Cobalt, working alongside Clifford Chance, advised Barclays, J.P. Morgan, and Societe Generale on the issuance of a 3-year Eurobond by the Republic of Latvia in an amount of EUR 1 billion. Allen & Overy advised the Republic of Latvia. | EUR1billion | Latvia | Here |
24-Apr | Cobalt | Cobalt advised arranger and sole book-runner AB SEB Bankas on financial institution Altum's issuance of EUR 20 million notes. | EUR20million | Latvia | Here |
30-Apr | Sorainen | Sorainen advised NEFCO on its investment in the Second Mezzanine Fund, which is managed by FlyCap. | N/A | Latvia | Here |
11-May | Sorainen | Sorainen represented YIT Latvija in a dispute over the legality of a construction permit. | N/A | Latvia | Here |
15-May | Cobalt | Cobalt assisted with the drafting of the terms and conditions of moratoria introduced by Latvian banks and liaised with the Latvian competition authority to obtain backing for the process and outcome of negotiation. | N/A | Latvia | Here |
20-May | Kronbergs Cukste Levin; Primus Derling; Vilgerts | Kronbergs Cukste Levin advised environment management group Eco Baltia on the sale of a controlling stake in the company to INVL Baltic Sea Growth Fund. Vilgerts and Primus Derling advised the buyers on the deal. | N/A | Latvia | Here |
29-May | Sorainen | Sorainen advised Nasdaq CSD SE on a cross-border merger with Nasdaq CSD Iceland hf. | N/A | Latvia | Here |
17-Jun | TGS Baltic | TGS Baltic successfully defended the Anti-Doping Bureau of Latvia in the Court of Arbitration for Sport. | N/A | Latvia | |
1-Jul | TGS Baltic | TGS Baltic represented AS Retail Mezaparks in the purchase of land for the construction of a Rimi supermarket. | EUR2million | Latvia | |
7-Jul | TGS Baltic | TGS Baltic successfully represented the Anti-Doping Bureau of Latvia in the Court of Arbitration for Sport. | N/A | Latvia | Here |
10-Jul | Cobalt | Cobalt successfully represented Latvian Television in a copyright and competition dispute against All Media Latvia that reached Latvia's Supreme Court. | N/A | Latvia | Here |
14-Jul | Cobalt | Cobalt provided pro bono advice to the Apeirons Foundation regarding an opinion the latter submitted to the Constitutional Court of Latvia as amicus curiae. | N/A | Latvia | Here |
3-Aug | Cobalt | The Latvian office of Cobalt advised AirBaltic on a EUR 250 million investment in its shares by the Latvian Government. | EUR250million | Latvia | Here |
7-Aug | BDO Law | The Latvian office of BDO Law provided legal analysis to the European Investment Bank regarding a EUR 80 million financing agreement with the Latvian state. | EUR80million | Latvia | Here |
13-Aug | BDO Law | BDO Law advised Deichmann-Schuhe Service-GmbH on its investment of EUR 500,000 in its Latvian subsidiary, SIA Deichmann Apavi, that increased its capital to EUR 1.15 million. | EUR500000 | Latvia | Here |
20-Aug | Loyens & Loeff; Sorainen | Sorainen and Loyens & Loeff advised the Kekava ABT consortium on its agreement with Latvian State Roads to construct the Kekava Bypass part of the Via Baltica. | EUR100million | Latvia | Here |
27-Aug | Sorainen | Sorainen advised the Sarmants event planning association in an intellectual property dispute. | N/A | Latvia | Here |
28-Aug | Cobalt; TGS Baltic | TGS Baltic advised Moller Real Estate Baltic AS on the acquisition of a land plot near the Riga International Airport and an office-warehouse building located on it. Cobalt advised the unidentified sellers on the deal. | N/A | Latvia | Here |
31-Aug | Cobalt | Cobalt successfully represented the Latvian Television TV network before the Administrative District Court and Administrative Regional Court of Latvia against an association of political parties challenging the rules set by the network related to the allocation of airtime leading up to parliamentary elections. | N/A | Latvia | Here |
14-Sep | Sorainen | Sorainen advised Brette Haus on the preparation of a sales contract template for prefabricated folding houses. | N/A | Latvia | Here |
18-Sep | Cobalt; Orrick | Cobalt advised capital300 and Chalfen Ventures on a EUR 5 million series A investment into Riga-based startup Lokalise. Orrick advised the start-up. | EUR5million | Latvia | Here |
22-Sep | Ellex (Klavins) | Ellex Klavins helped Gulbenes Autobuss and Balvu Autotransports successfully contest a procurement award involving a regional passenger carriage in Latvia to the country's Procurement Monitoring Bureau. | N/A | Latvia | Here |
28-Sep | Actus Q; Cobalt | Cobalt advised Dithmarschen Baltic GmbH on its acquisition of 100% of Dan-Lat Invest and ODK & RB. Actus Q advised the sellers on the deal. | N/A | Latvia | Here |
30-Sep | Cobalt | Cobalt represented Latvia's Central Election Commission in proceedings before the Regional Administrative Court in Riga regarding the annulment of extraordinary elections to the Riga City Council. | N/A | Latvia | Here |
13-Oct | Cobalt | Cobalt advised two natural persons in an administrative appeal of a decision of Latvia's Office of Citizenship and Migration Affairs denying them residence permits due to non-compliance with the provisions of the Immigration Law. | N/A | Latvia | Here |
30-Oct | Sorainen; TGS Baltic | TGS Baltic advised Latvia's SIA Tepix on the sale of its carpet rental business to SIA Lindstrom. Sorainen advised Lindstrom on the deal. | N/A | Latvia | Here |
5-Nov | Cobalt; Sorainen | Cobalt advised Latvian IT company Tilde on the sale of its Jumis Pro accounting and business management system business to Nordic IT company Visma. Sorainen advised Visma on the deal. | N/A | Latvia | Here |
6-Nov | Sorainen | Sorainen advised Lords LB Baltic Fund III, managed by the Lithuanian investment company Lords LB Asset Management, on the sale of a logistics center in Riga to EfTEN Real Estate Fund 4. | N/A | Latvia | Here |
6-Nov | Sorainen | Sorainen advised the Vienna Insurance Group on its acquisition of the remaining 9.17% shares in BTA Baltic Insurance Company from AAS Balcia, making VIG the company's sole shareholder. | N/A | Latvia | Here |
6-Nov | Glimstedt; Sorainen | Sorainen Latvia advised Isnaudas Forest Holding on the sale of its five subsidiaries to SCA Mezs Latvija. Glimstedt advised Mezs Latvija on the deal. | EUR44.5million | Latvia | Here |
26-Nov | Cobalt | Cobalt, acting pro bono, represented the "Association of LGBT and Their Friends Mozaika" as amicus curiae before the Constitutional Court of Latvia regarding the right of same-sex couples to parental leave. | N/A | Latvia | Here |
27-Nov | Sorainen | Sorainen advised the USS Grupp on its acquisition of the Latvian branch of the Securitas security services company. | N/A | Latvia | Here |
16-Dec | Cobalt; Ecovis | Cobalt advised the Eurion Fund on the acquisition of an office buildng in Riga from the Baltic RE Group. Ecovis Convents Law Office advised the Baltic RE Group on the deal. | N/A | Latvia | Here |
23-Dec | Cobalt | Cobalt's Riga office successfully represented SIA Latsson Licensing, the owner of online gaming platform Betsafe Latvia, before the Constitutional Court of Latvia regarding the restrictions on its provision of interactive gaming services during a state of emergency. | N/A | Latvia | Here |
21-Dec | TGS Baltic | TGS Baltic represented SIA GLD Company in a real estate sale transaction in the Marupe district near Riga. | N/A | Latvia | |
2-Mar | Sorainen | Sorainen advised Credit Suisse on matters of Latvian and Lithuanian law related to its EUR 27 million loan to Amber Beverage Group, | EUR27million | Latvia; Lithuania | |
2-Apr | Sorainen | Sorainen, working alongside Sweden's Mannheimer Swartling, is advising KPMG Sweden on its acquisition of KPMG Latvia and KPMG Lithuania. | N/A | Latvia; Lithuania | Here |
22-Apr | Sorainen | Sorainen successfully represented Lithuania's E Energija against the Republic of Latvia in an ICSID arbitration. | N/A | Latvia; Lithuania | Here |
9-Jun | TGS Baltic | TGS Baltic helped Utenos Trikotazas AB optimize its operations and dispose of certain assets. | N/A | Latvia; Lithuania | |
15-Aug | TGS Baltic | TGS Baltic assisted Baltic Mill with the drafting of templates for the group's business operations. | N/A | Latvia; Lithuania | |
31-Aug | Ellex (Klavins); Ellex (Valiunas); Triniti | Ellex advised Quaero European Infrastructure Fund II on the acquisition of Digitalas Ekonomikas Attistibas Centrs from Solo Investments SIA, Astondesmit Astoni SIA, Duo Investicijas SIA, and KFP SIA. Triniti advised the sellers on the transaction. | N/A | Latvia; Lithuania | Here |
8-Sep | Cobalt; Glimstedt | Glimstedt advised UAB CGP Management on the sale of four private medical service operators in Lithuania to Latvia's Repharm healthcare group. Cobalt advised Repharm on the deal. | N/A | Latvia; Lithuania | Here |
27-Oct | Cobalt | Cobalt advised Latvia's Repharm healthcare group on the acquisition of a network of MediCA, Kardiolita, and 33 other clinics from UAB CGP Management, and their subsequent merger with InMedica, a network of medical clinics indirectly managed by the INVL Baltic Sea Growth Fund. | N/A | Latvia; Lithuania | Here |
10-Nov | TGS Baltic | TGS Baltic assited Zemaitijos Pienas AB with investments in SIA Muizas Piens. | N/A | Latvia; Lithuania | |
2-Jan | Sorainen | Sorainen advised investment management company Orion Asset Management on the acquisition by its SPV-39 subsidiary of Pletros Investicijos, the company managing the "Palanga Bypass" - a 8.25 part of the road from Klaipeda to Liepaja in Lithuania - via a public-private partnership. | N/A | Lithuania | Here |
2-Jan | TGS Baltic | TGS Baltic advised AUGA group, AB on a bond program worth up to EUR 60 million and the issuance of EUR 20 million in green bonds in Lithuania. | EUR80million | Lithuania | Here |
3-Jan | Fort; TGS Baltic | Fort Legal advised Gateway Airport Services on its acquisition of 100% shares of Litcargus, an aircraft ground handling company in Vilnius. TGS Baltic advised the sellers, Central European Airport Services S.A, a company managed by Royalton Partners. | N/A | Lithuania | Here |
3-Jan | Sorainen | Sorainen advised InMedica medical clinic network on its issuance of bonds planned for listing on First North, an alternative securities market administered by Nasdaq Vilnius. | EUR5million | Lithuania | Here |
17-Jan | SPC Legal | SPC Legal successfully represented UAB T Parkas in a dispute regarding the termination of a state-owned land lease agreement with another user of the land plot. | N/A | Lithuania | Here |
17-Jan | SPC Legal | SPC Legal advised UAB Akmenes Projektai, a company managed by Domestique Asset Management, on unspecified investment agreements with Akmene FEZ Management Company in the Akmene free economic zone in Lithuania. | N/A | Lithuania | Here |
17-Jan | Cobalt; Walless | Walless advised the Affidea Group on its acquisition of 100% of the shares of UAB Kuncu Ambulatorine Klinika, the operator of the Vetrunge clinic in Klaipeda, Lithuania. Cobalt advised the unidentified seller on the deal. | N/A | Lithuania | Here |
17-Jan | Sorainen; Walless | Walless advised Spanish companies Elecnor and Abengoa on their agreement to electrify the Vilnius railway hub and the Kaisiadorys-Klaipeda railway for Lithuania's state-owned railway company Lietuvos Gelezinkeliai. Sorainen advised Lietuvos Gelezinkeliai on the contract. | EUR363million | Lithuania | Here |
22-Jan | Sorainen; SPC Legal | SPC Legal advised real estate investment company Capital City Group on the sale to a company managed by Kenova Asset Management of a tunnel car-wash station in Lithuania that is leased by UAB Svaros Broliai. Sorainen advised the buyers on the deal. | N/A | Lithuania | Here |
24-Jan | Sorainen | Sorainen advised Rocket Software on opening a new development center in Vilnius. | N/A | Lithuania | Here |
27-Jan | Deloitte Legal | The Lithuanian office of Deloitte Legal advised Aurora Cannabis Inc. on the merger of its two Lithuanian subsidiaries, Agropro and Borela. | N/A | Lithuania | Here |
28-Jan | Sorainen | Sorainen advised venture capital fund Startup Wise Guys on its investment in Lithuanian transport management system developer GoRamp. | N/A | Lithuania | Here |
31-Jan | DLK Legal | DLK Legal helped Digital Virgo obtain an e-money institution license for Lithuania's Digital Virgo Payment UAB. | N/A | Lithuania | Here |
4-Feb | Derling Primus | Derling Primus helped NBC Security, Inc. establish UAB Baltic Defense Industries, which will manufacture military and defense products in Lithuania for global defense and law enforcement agencies. | N/A | Lithuania | Here |
4-Feb | Cobalt | Cobalt advised Iron Wolf Capital on its EUR 1.6 million investment in Integrated Fiber Optics. | EUR1.6million | Lithuania | Here |
6-Feb | Ellex (Valiunas); Motieka & Audzevicius | Motieka & Audzevicius advised MyFitness, a sports and fitness club operator, on the acquisition of Lithuania-based Gym Plius. Ellex Valiunas advised the unidentified sellers on the deal. | N/A | Lithuania | Here |
7-Feb | BBA Fjeldco; Motieka & Audzevicius | Motieka & Audzevicius advised Avia Solutions Group on the acquisition of Bluebird Nordic, a cargo airline headquartered in Iceland. Bluebird Nordic was reportedly advised by Iceland's BBA//Fjeldco law firm. | N/A | Lithuania | Here |
7-Feb | Ellex (Valiunas); Tenden | Ellex Valiunas and Norway's Tenden law firm advised Norway's Passer Group on its acquisition of 49% of shares in Lithuania's SIDC Group. | N/A | Lithuania | Here |
12-Feb | Ashurst; Sorainen | Sorainen won a tender to advise Lithuania's state-owned Ignitis Group on an initial public offering it is currently considering. Ashurst will be advising on English and US law aspects. | N/A | Lithuania | Here |
19-Feb | Cobalt | Cobalt advised Genopas B.V. and Nunica Holdings B.V. on the sale of their 100% shareholding in UAB Pusbroliai to Idex Baltic. | N/A | Lithuania | Here |
20-Feb | Sorainen | Sorainen advised Baltic Mill on its third bond issuance and the bonds' listing on Nasdaq Baltic First North, an alternative bond market managed by Nasdaq Vilnius. Sorainen also advised arranger Siauliu Bankas on the deal. | EUR3million | Lithuania | Here |
25-Feb | Adon Legal | Adon Legal helped Seili UAB set-up its operations as a consumer credit provider and mortgage credit provider. | N/A | Lithuania | Here |
28-Feb | Ellex (Valiunas) | Ellex Valiunas helped Lords LB Baltic Fund IV negotiate a lease agreement for a building in Vilnius with Northern Lyceum. | N/A | Lithuania | Here |
4-Mar | Walless | Walless advised Tadas Bulotas on the sale of Lithuania's BBaltics sports agency to the Wasserman sports agency. | N/A | Lithuania | Here |
4-Mar | Cobalt; Ellex (Valiunas) | Ellex Valiunas advised Fan19 on its acquisition of Engagecraft. Cobalt advised the unidentified seller on the deal. | N/A | Lithuania | Here |
5-Mar | Sorainen | Sorainen advised Autoukis NT on the sale of a complex of buildings in Vilnius to a company controlled by the Hanner Group. | N/A | Lithuania | Here |
5-Mar | Pohla & Hallmagi | Pohla & Hallmagi advised Norway's Selvaag Eastern European Development Fund OU on the sale of its LIthuanian subsidiary, UAB Parkavimo Paslaugos, to UAB Baltexpro. | N/A | Lithuania | Here |
11-Mar | Sorainen | Sorainen successfully defended HR solutions provider Amston before Lithuania's Equal Opportunities Ombudsperson. | N/A | Lithuania | Here |
11-Mar | SPC Legal | SPC Legal successfully represented the non-profit Baltic Environmental Forum in Vilnius' Administrative Court in its claim that the State Service for Protected Areas unlawfully suspended the expansion of Lithuania's Punia pinewood reserve. | N/A | Lithuania | Here |
16-Mar | TGS Baltic | TGS Baltic successfully represented Orlen Lietuva before the Court of Appeal of Lithuania in a dispute regarding Polocktransneft Druzhba's claim for damages of over USD 70 million. | USD70million | Lithuania | Here |
24-Mar | Motieka & Audzevicius | Motieka & Audzevicius helped Nandi Finance obtain an electronic money institution license from the Bank of Lithuania. | N/A | Lithuania | Here |
26-Mar | Sorainen | Sorainen helped E4F Money obtain an electronic money institution license in Lithuania. | N/A | Lithuania | Here |
30-Mar | Sorainen | Sorainen advised the Ignitis Group on the receipt of a loan by Pomerania Wind Farm, a Polish company belonging to the group, of a loan from EIB. | PLN258million | Lithuania | Here |
1-Apr | TGS Baltic | TGS Baltic successfully defended Klaipedos Naft before the Court of Appeal of Lithuania in a case involving EUR 6 million in damages. | EUR6million | Lithuania | Here |
3-Apr | Ellex (Valiunas) | Ellex Valiunas successfully defended the interests of the Kaunas City Municipality in a dispute involving the termination of a contract for the reconstruction of S. Darius and S. Girenas Stadium under public procurement rules. | N/A | Lithuania | Here |
6-Apr | TGS Baltic | TGS Baltic advised Viada LT on its issuance of EUR 1 million worth of bonds, which will be included to trading on Lithuania's alternative First North stock exchange. | EUR1million | Lithuania | Here |
7-Apr | Motieka & Audzevicius | Motieka & Audzevicius is representing big data company Oxylabs in an IP rights infringement dispute in Lithuania. | N/A | Lithuania | Here |
16-Apr | Motieka & Audzevicius | Motieka & Audzevicius successfully represented AVAgro LLC in a dispute with Singapore-based Dreymoor regarding interim measures pertaining to assets of AVAgro's subsidiary, AVAgro UAB. | N/A | Lithuania | Here |
16-Apr | Motieka & Audzevicius | Motieka & Audzevicius successfully represented Axis Industries in an insurance indemnification dispute. | N/A | Lithuania | Here |
20-Apr | Sorainen | Sorainen advised Lords LB Special Fund I Subfund B investment fund on its lease of a 7000 square meter area in its Lvovo business center in Vilnius to Telia Global Services Lithuania. | N/A | Lithuania | Here |
23-Apr | Nove | Nove advocates Veikko Puolakainen and Veiko Vaske successfully represented the Political Parties' Supervision Commission in Lithuania's Supreme Court. | N/A | Lithuania | Here |
23-Apr | Sorainen | Sorainen successfully represented Alfa Bank as the creditor of Arvi Ir Ko in a case concerning the annulment of Arvi Ir Ko sales transactions. | N/A | Lithuania | Here |
23-Apr | Sorainen | Sorainen provided pro bono advice to Invega on Covid-19 measures for affected businesses. | N/A | Lithuania | Here |
30-Apr | Motieka & Audzevicius; TGS Baltic | Motieka & Audzevicius advised the founders of Lithuania's In Balance Grid on the investment of EUR 950,000 into the company by Koinvesticinis Fondas, Contrarian Ventures, and several angel investors, all of which were advised by TGS Baltic. | EUR950000 | Lithuania | Here |
4-May | Triniti | Triniti advised the Groa Real Estate Fund I, a fund managed by Groa Capital, on the acquisition of the Rimi Hypermarket shopping center in Vilnius from UAB Sun Invest. | N/A | Lithuania | Here |
6-May | Dentons; Sorainen; TGS Baltic | Sorainen advised joint lead managers BNP Paribas, Citi, and Erste Group on a dual-tranche Eurobond issue by the Republic of Lithuania - a 5-year Eurobond of EUR 750 million face value and a 10-year Eurobond of EUR 1 billion 250 million face value. | EUR2billion | Lithuania | Here |
6-May | Sorainen; Triniti | Triniti helped Eddy Travels, a Lithuanian startup developing an artificial-intelligence-based digital travel planning assistant, to raise an additional EUR 600,000 to complete an approximately EUR 1.1 million early-stage funding round. Lead investor KUB Open Circle Capital was advised by Dentons. | EUR600000 | Lithuania | Here |
11-May | TGS Baltic | TGS Baltic advised Siauliu Bankas on the issuance of EUR 20 million subordinated bonds and their listing on Nasdaq Vilnius's Debt Securities List. | EUR20million | Lithuania | Here |
12-May | Sorainen; TGS Baltic | Sorainen advised Nitin Shelke, the founder and chairman of Growmore Group, on its acquisition of Medicinos Bankas, a retail bank in Lithuania with USD 395 million in assets, from Konstantinas Karosas and Western Petroleum Limited. The sellers were advised by TGS Baltic. | USD395million | Lithuania | Here |
15-May | Sorainen | Sorainen advised Orkela on the conversion of the former Sv. Jokubo hospital in the Vilnius city center into a hotel. | N/A | Lithuania | Here |
26-May | Ellex (Valiunas); Euroteises Biuras | Ellex Valiunas advised Northern Ireland's Mzuri Holdings on the acquisition of 60% stake in Lithuanian window covering manufacturer Domus Lumina. Euroteises Biuras advised Domus Lumina. | N/A | Lithuania | Here |
27-May | TGS Baltic | TGS Baltic successfully defended the interests of TV Play at the Supreme Administrative Court of Lithuania against the Radio and Television Commission of Lithuania in a dispute involving the "must carry" obligation under Lithuanian law. | N/A | Lithuania | Here |
27-May | Motieka & Audzevicius | Motieka & Audzevicius successfully represented the Republic of Serbia before the Lithuanian Court of Appeals in a case regarding the enforcement of Serbia's EUR 12 million claim against am unspecified Lithuanian company. | EUR12million | Lithuania | Here |
28-May | Cobalt; Sorainen | Cobalt advised Lithuania's AB Lietuvos Radijo ir Televizijos Centras on the sale of its data transmission and digital television business developed under the Mezon brand to Lithuania's Bite Group. Sorainen advised Bite on the deal. | N/A | Lithuania | Here |
29-May | Clifford Chance; Dentons; TGS Baltic; Walless | TGS Baltic and Dentons advised the Ignitis group on its renewed EUR 1.5 billion medium-term debt securities program and EUR 300 million bond issuance. Clifford Chance and Walles advised intermediaries BNP Paribas, Citi, J.P. Morgan, and Luminor bank. | EUR300million | Lithuania | Here |
1-Jun | Sorainen; TGS Baltic | Sorainen advised Danielius Merkinas and Ceslovas Kazlauskas, the founders of NNL LT, on the acquisition of a 44% stake in NNL LT from Litcapital through an acquisition vehicle. TGS Baltic advised Litcapital. | N/A | Lithuania | Here |
8-Jun | Sorainen; SPC Legal | Sorainen advised venture capital fund Open Circle Capital on an unspecified investment in Lithuanian marketing startup Billo. SPC Legal advised Billo. | N/A | Lithuania | Here |
10-Jun | Cobalt | Cobalt advised APX on an unspecified pre-seed investment in Haslle. | N/A | Lithuania | Here |
15-Jun | Cerniauskas & Partners; Glimstedt; TGS Baltic | TGS Baltic advised venture capital fund Koinvesticinis Fondas and four other business angels on their investment of EUR 210,000 in Lithuanian start-up Funkciniai Gerimai. Cerniauskas & Partners advised Funkciniai Gerimai on the deal, while Glimstedt advised the business angels. | EUR210000 | Lithuania | Here |
15-Jun | Ellex (Valiunas); TGS Baltic | Ellex Valiunas advised Quaero European Infrastructure Fund II on the acquisition of UAB Duomenu Logistikos Centras from energy company Ignitis Group and Litgrid. TGS Baltic advised the sellers on the transaction. | EUR10.1million | Lithuania | Here |
16-Jun | Ellex (Valiunas) | Ellex Valiunas persuaded the Supreme Court of Lithuania to rule that the Kaunas City Municipality may continue centralizing food purchases for pre-school education institutions. | EUR900000 | Lithuania | Here |
17-Jun | Walless | Walless helped the Ambr Group's set up a Lithuanian subsidiary - Ambr Payments UAB - and obtain an electronic money license from the Bank of Lithuania to issue electronic money and provide payment services. | N/A | Lithuania | Here |
23-Jun | Cobalt; Sorainen | Cobalt advised Western Union Processing Lithuania on its lease of more than 15,000 square meters of office space from Finland's Technopolis real estate investment and management company, which was advised by Sorainen. | N/A | Lithuania | Here |
23-Jun | Sorainen; Walless | Sorainen advised electronic money institution Verse Payments Lithuania on its acquisition by Square, an electronic payment and financial services company headquartered in San Francisco and listed on the New York Stock Exchange. Walless advised Square. | N/A | Lithuania | Here |
26-Jun | Sorainen | Sorainen assisted the Kino Pavasaris Vilnius International Film Festival on the removal of counterfeit copies of the Oscar-winning movie "Parasite" from illegal torrent sites in Lithuania. | N/A | Lithuania | Here |
2-Jul | Sorainen | Sorainen advised Koinvesticinis Fondas on the investment, made along with three business angels, of EUR 100,000 in Lithuanian startup Cogastro, which developed the world's first computer program for insect farm monitoring and management. | EUR100000 | Lithuania | Here |
3-Jul | Sorainen; Walless | Sorainen advised the Darnu Group on the sale of the 15,000 square meter East Hill building in Vilnius's Park Town business center to an investment company jointly owned by the Zenith Family Office and the Dao Family Office. Walless advised the buyers on the transaction. | N/A | Lithuania | Here |
14-Jul | Sorainen | Sorainen advised Koinvesticinis Fondas on its investment in Nanoenergija, a Lithuanian startup that developed vibration energy harvesting technology to power wireless IoT sensors. | N/A | Lithuania | Here |
21-Jul | TGS Baltic | TGS Baltic successfully represented Valstybiniu Misku Uredija -Lithuania's state-owned enterprise responsible for the supervision, administration, and inventory of state forests - before the Supreme Court of Lithuania. | N/A | Lithuania | Here |
22-Jul | SPC Legal | SPC Legal advised UAB Leteja on the sale of Hotel Conti, located in Vilnius' Old Town, to UAB NS Consulting. | N/A | Lithuania | Here |
22-Jul | TGS Baltic | TGS Baltic advised the Opera Limited browser provider on its acquisition of Fjord Bank. | N/A | Lithuania | Here |
24-Jul | Cobalt | Cobalt helped Lithuania's UAB Kedainiai Free Economic Zone draft establishment and operation agreements for Kormotech. | N/A | Lithuania | Here |
28-Jul | Cobalt | Cobalt advised the EBRD, Swedbank, and Citadele Bank on their provision of a EUR 86 million syndicated loan to UAB Vakaru Medienos Grupe in Lithuania. | EUR86million | Lithuania | Here |
30-Jul | Sorainen | Sorainen successfully defended the interests of the Union of Lithuanian Journalists and other journalists in a case investigated by Lithuania's Supreme Administrative Court regarding defense of that country's constitutional right to receive, collect, and share information. | N/A | Lithuania | Here |
4-Aug | Sorainen | Sorainen advised Alfa Bank on debt recovery efforts against Lithuanian businessman Vidmantas Kucinskas, as well as identifying possibly illegal acts by Kucinskas, who is suspected of financial fraud. | N/A | Lithuania | Here |
5-Aug | Dentons; Sorainen; TGS Baltic | The Vilnius office of Sorainen advised dealers BNP Paribas, Citi, and Erste Group on Lithuania's raising of EUR 1.75 billion by means of a 30-year Eurobond issue. | EUR1.75billion | Lithuania | Here |
7-Aug | Iustum; Sorainen | Sorainen advised the Darnu Group on a construction agreement with UAB Naresta for the sixth stage of the Paupys district of Vilnius, in Lituania. UAB Naresta was reportedly advised by the Iustum law firm. | N/A | Lithuania | Here |
11-Aug | Sorainen | The Lithuanian office of Sorainen advised Koinveticinis Fondas on its investment in Ligence, a Lithuanian startup developing an automated cardiac ultrasound diagnostic solution based on artificial intelligence. | EUR360000 | Lithuania | Here |
17-Aug | Motieka & Audzevicius | Motieka & Audzevicius helped CommonSign obtain a payment institution license for account information services. | N/A | Lithuania | Here |
19-Aug | Cobalt; Fort | Cobalt advised UAB Sonex Consulting on the sale of a 6,948 square meter business center in Vilnius to EfTen Real Estate Fund III, which is managed by EfTEN Capital. Fort Legal advised EfTen on the deal. | N/A | Lithuania | Here |
24-Aug | Andersen Partners; Deloitte Legal | Deloitte Legal and Denmark's Andersen Partners advised Maskinhandler Indkobsringen A/S, a Danish farm equipment company, on the sale of a majority stake of shares in MI Agrotinklas UAB to one of MI Agrotinklas's founders. | N/A | Lithuania | Here |
25-Aug | Sorainen | Sorainen advised Inion LT on a EUR 500,000 investment in the company by venture capital funds Koinvesticinis Fondas and Contrarian Ventures and startup accelerator 70 Ventures. | EUR500000 | Lithuania | Here |
27-Aug | Ellex (Valiunas); Glimstedt | Glimstedt advised GE Energy Financial Services on an unspecified investment in E Energija's 68.9MW wind farm in Telsiai, Lithuania, which uses GE's Cypress 5.3MW turbines. E Energija was advised by Ellex Valiunas. | N/A | Lithuania | Here |
31-Aug | Ellex (Klavins); Ellex (Valiunas) | Ellex Valiunas and Ellex Klavins advised infrastructure investment fund QEIF II on the acquisition of 100% of the shares of Citatalas Economic Development Center. | N/A | Lithuania | Here |
31-Aug | Motieka & Audzevicius | Motieka & Audzevicius helped Donatas Aleksandravicius, the owner of the Ds Byggeri construction company, file an indemnification claim against Denmark at the ICSID. | N/A | Lithuania | Here |
2-Sep | Walless | Walless advised E Energija on a green energy purchase deal with Eesti Energia. | N/A | Lithuania | Here |
2-Sep | Motieka & Audzevicius; Sorainen | Sorainen and Motieka & Audzevicius advised Startup Wise Guys and the Motieka Investment Fund on a EUR 1.2 million investment in Lithuanian edu-tech start-up Turing College. Motieka & Audzevicius also advised Turing College on the deal. | EUR1.2million | Lithuania | Here |
3-Sep | Walless | Walless helped Railsbank Group subsidiary UAB Payrnet obtain an electronic money institution license from the Bank of Lithuania. | N/A | Lithuania | Here |
8-Sep | Accura; Cobalt; Gessel; Horten; Norton Rose Fulbright | The Lithuanian office of Cobalt and Denmark's Accura law firm advised INVL Baltic Sea Growth Fund on its acquisition of a 48% stake in MBL from Accession Mezzanine Capital III and the Lauritsen family. The Horten, Gessel, and Norton Rose Fulbright law firms reportedly advised the sellers. | N/A | Lithuania | Here |
10-Sep | Watson Farley & Williams | Watson Farley & Williams advised the Froelich family on their sale of Froelich Internationale Transporte GmbH & Co. KG to Lithuania's Transimeksa Group. | N/A | Lithuania | Here |
28-Sep | Ashurst; Debevoise & Plimpton; Dentons; Linklaters; Sorainen; TGS Baltic; Walless | Sorainen, Linklaters, and Ashurst advised Lithuania's state-owned Ignitis Group on its initial public offering and admission to the Vilnius and London stock exchanges. Walless and Dentons advised bookrunners Bank of America, JP Morgan, Morgan Stanley, Swedbank, and UBS on the offering. TGS Baltic and Debevoise & Plimpton advised GDR depositary Bank of New York Mellon. | EUR450million | Lithuania | Here |
30-Sep | Sorainen | Sorainen is representing 15min, a news website in Lithuania, in an appeal against a warning issued by Lithuania's State Consumer Rights Protection Authority commission. | N/A | Lithuania | Here |
2-Oct | TGS Baltic | TGS Baltic established a pro bono partnership with the Kazickas Family Foundation, an international non-profit organization that supports education, social welfare, technology, culture, and medicine projects in the United States of America, Lithuania, and Africa. | N/A | Lithuania | Here |
5-Oct | DLA Piper | DLA Piper advised Lithuania's Ignitis Group on its acquisition of a 5% stake in the Moray West wind farm project on the east coast of Great Britain currently under development by Ocean Winds, which was established earlier this year as a joint venture by French energy giants Engie and EDPR. | N/A | Lithuania | Here |
6-Oct | Walless | Walless advised Eastnine on the acquisition of an office property in central Vilnius. | EUR20million | Lithuania | Here |
8-Oct | Sorainen | Sorainen helped establish the Aid Fund for Business, which will invest public and private funds in enterprises affected by Covid-19. | N/A | Lithuania | Here |
12-Oct | Triniti (Triniti Jurex) | Triniti Jurex successfully represented Restaurants Group Fortas in a dispute with an unnamed insurance company. | N/A | Lithuania | Here |
14-Oct | Glimstedt | Glimstedt successfully represented Nigeria's Arik Air Limited in a cross-border debt collection enforcement case in the Kaunas Regional Court. | EUR2million | Lithuania | Here |
16-Oct | Triniti (Triniti Jurex) | Triniti Jurex successfully defended the Lithuanian Radio and Television Center Telecentras and its CEO, Remigijus Seris, against a defamation lawsuit filed by the former President of the Lithuanian Business Confederation, Valdas Sutkus. | N/A | Lithuania | Here |
16-Oct | Triniti (Triniti Jurex) | Triniti Jurex successfully represented the Visoriu Slenio Gyventoju Bendruomene association in its petition to the Supreme Administrative Court of Lithuania to order a reevaluation of the environmental impact study regarding planned construction of the M. Lietuvio Street bypass in Vilnius. | N/A | Lithuania | Here |
16-Oct | Sorainen | Sorainen's Lithuanian office helped Dexcom establish a global business service center in Vilnius, Lithuania. | N/A | Lithuania | Here |
19-Oct | Motieka & Audzevicius; Sorainen | Sorainen represented Seven Entertainment and its shareholders in the sale of Lithuania's Siemens and Cido multi-purpose arenas, the Tiketa ticket distribution company, and the Seven Live event organization company, to Lithuania's DG21. Motieka & Audzevicius advised the buyer on the deal. | N/A | Lithuania | Here |
21-Oct | Cobalt; Wint | Cobalt advised Arunas Kuraitis on a lease of a building in Vilnius's Old Town from Lithuania's Jesuit Province. Wint advised the Jesuit Province on the deal. | N/A | Lithuania | Here |
21-Oct | Cobalt | Cobalt advised Practica Capital on the final close of the Practica Venture Capital II fund, which included a EUR 2 million investment from Swedbank Asset Management. The total fundraising amount reached EUR 28.5 million. | EUR2million | Lithuania | Here |
28-Oct | Triniti (Triniti Jurex) | Triniti Jurex helped Termolink obtain damages from a general contractor for work the company performed on an unspecified project. | N/A | Lithuania | Here |
2-Nov | Marger | Marger Law Firm successfully represented Lithuania's Svencionys municipality in a dispute with an unspecified contractor about the effectiveness of a previous arbitration award that was heard by the Supreme Court of Lithuania. | N/A | Lithuania | Here |
2-Nov | Ellex (Valiunas) | Ellex Valiunas helped Curve obtain an electronic money institution license from the Bank of Lithuania and transfer its European activities to the country. | N/A | Lithuania | Here |
4-Nov | Cobalt; Fort | Fort Legal advised Broadcast Solutions on its acquisition of Lithuania's TVC Solutions from Practica Capital and four other unidentified shareholders. Cobalt advised the sellers. | N/A | Lithuania | Here |
11-Nov | Motieka & Audzevicius | Motieka & Audzevicius successfully represented road construction company Panevezio keliai in several cases against the Vilnius municipality administration related to infringements in the EUR 40 million tender procedures for reconstruction of one of the major intersections in Vilnius. | EUR40million | Lithuania | |
17-Nov | Kromann Reumert; Walless | Walless advised Sapiens International Corporation on its acquisition of Tia Technologies from EQT Mid Market. Kromann Reumert advised the seller on the deal. | N/A | Lithuania | Here |
18-Nov | Sorainen | Sorainen advised Bittiq, a Netherlands-based account information manager, on the launch of its business in Lithuania. | N/A | Lithuania | Here |
18-Nov | iLaw; SPC Legal | SPC Legal advised the Panevezys free economic zone of Lithuania on an investment from cable harness manufacturer AQ Wiring Systems. iLaw advised AQ Wiring Systems on the deal. | N/A | Lithuania | Here |
18-Nov | Primus; TGS Baltic | TGS Baltic advised the shareholders of the Baltic hotel services portal NoriuNoriuNoriu on the sale of 90% of the shares of UAB NoriuNoriuNoriu to UAB Disrupta. | N/A | Lithuania | Here |
23-Nov | Fort | Fort advised the EIKA real estate development company on a five million bond issue, distributed by Siauliu Bankas. | EUR5million | Lithuania | Here |
27-Nov | Eversheds Sutherland; Squire Patton Boggs; Walless | Squire Patton Boggs and Eversheds Sutherland advised the Miss Group on its acquisition of Interneto Vizija from its founders. Walless advised the sellers on the deal. | N/A | Lithuania | Here |
27-Nov | Walless | Walless advised DiPocket on setting up a subsidiary in Lithuania and obtaining an electronic money institution license from the Bank of Lithuania. | N/A | Lithuania | Here |
27-Nov | Ellex (Valiunas) | Ellex Valiunas advised Norway's Baltic Sea Properties real estate management company on its sale of 13 buildings to Rivona, a subsidiary of the Norfa Group. | N/A | Lithuania | Here |
27-Nov | Sorainen | Sorainen advised the Modus Group on its launch of a second public bond issuance, expected to attract investment of EUR 8 million. The bonds are being distributed by Saiuliu Bankas and will be traded on First North, an alternative market administrated by Nasdaq. | N/A | Lithuania | Here |
27-Nov | TGS Baltic | TGS Baltic successfully represented Lithuanian Airports in a dispute with the Active Construction Management over major repairs carried out in Vilnius Airport. | N/A | Lithuania | Here |
27-Nov | TGS Baltic | TGS Baltic advised the Maxima Group on the merger of its Maxima LT and (Netherlands-based) Lincoln Land Erste subsidiaries. | N/A | Lithuania | Here |
27-Nov | Motieka & Audzevicius | Motieka & Audzevicius successfully represented the Panevezio Keliai road construction company in a dispute against the City of Vilnius administration. | EUR500000 | Lithuania | Here |
27-Nov | Sorainen | Sorainen advised Startup Wise Guys on its investment in logistics startup GoRamp. Startup Wise Guys, together with Presto Ventures, invested EUR 450,000. | EUR450000 | Lithuania | Here |
1-Dec | Triniti (Triniti Jurex) | Triniti Jurex defended the interests of AB Lietuvos Radijo Ir Televizijos Centras in a dispute with the Darnu Group over an EUR 6 million sale of real estate. | EUR6million | Lithuania | Here |
3-Dec | Walless | Walless advised Norway's BCP Logistic Property III on its sale of the Lithuania's Vinges Terminalas logistics center. | EUR10million | Lithuania | Here |
3-Dec | Cobalt; Sorainen | Sorainen advised the INVL Sustainable Timberland and Farmland Fund II on its EUR 13.6 million acquisition of seven companies from the Linas Agro Group, advised by Cobalt. | EUR13.6million | Lithuania | Here |
4-Dec | Walless | Walless helped Crius LT obtain a specialized banking license from the European Central Bank, following the Bank of Lithuania's assessment and proposal. | N/A | Lithuania | Here |
4-Dec | Walless | Walless advised Capitalica Baltic Real Estate Fund I on the issuance of EUR 3 million bonds and their listing on the First North market of Nasdaq Vilnius. | EUR3million | Lithuania | Here |
15-Dec | Cobalt | The Vilnius District Prosecutor's Office terminated a pre-trial investigation against the former Speaker of the Lithuanian Parliament, Arunas Valinskas, involving charges of incitement of hatred. Cobalt represented Valinskas in the process. | N/A | Lithuania | Here |
15-Dec | Fort; Sorainen | Sorainen's Lithuanian office advised the SBA Group on its EUR 28.6 million sale of a logistics center and a furniture component factory to Estonia's EfTEN Real Estate Fund 4. Fort advised the buyer on the deal. | EUR28.6million | Lithuania | Here |
15-Dec | Sorainen | Sorainen advised Emotika on attracting a EUR 100,000 investment from an unspecified US-based investor. | EUR100000 | Lithuania | Here |
21-Dec | Motieka & Audzevicius | Motieka & Audzevicius created an Anti-Money Laundering and Counter-Terrorist Financing program for Newsec Advisers LT. | N/A | Lithuania | Here |
21-Dec | Cobalt; Wint | Cobalt advised Practica Capital on the EUR 1 million investment it made along with a group of other, unidentified, private investors in the RRR.lt online platform, which facilitates the sale of used car parts. Wint advised the owner of the platform on the deal. | EUR1million | Lithuania | Here |
22-Dec | Sorainen | Sorainen advised TC Investicija on the sale of a building in Kaunas, Lithuania, to Integrated Stars. Financing for the transaction was provided by Citadele Bank. | N/A | Lithuania | Here |
23-Dec | DLK Legal | DLK Legal helped Finnovative Solutions UAB obtain a payment institution license from the Bank of Lithuania to provide Account Information Services and Payment Initiation Services. | N/A | Lithuania | Here |
24-Dec | Sorainen; Wint | Sorainen advised Decathlon on its agreement with the Galio Group to have the latter build and lease new stores for it in the Lithuanian cities of Kaunas and Klaipeda. Wint advised the Galio Group on the transaction in Klaipeda. | EUR8million | Lithuania | Here |
28-Dec | Sorainen | Sorainen advised Luxembourg's REInvest Asset Management and its DEREIF SICAV FIS fund on their acquisition of the building housing SEB Bank's headquarters in Vilnius from the Lords LB Special Fund II. | N/A | Lithuania | Here |
29-Dec | Walless | Walless helped Stanhope Financial establish a subsidiary in Lithuania and obtain an e-money institution license from the Bank of Lithuania. | N/A | Lithuania | Here |
29-Dec | Cobalt; Goodwin; Motieka & Audzevicius; Taylor Wessing | Motieka & Audzevicius together with Taylor Wessing advised the founders of Eneba Holdings Limited and Helis play on raising series A investment round by well-known venture capital investors. The series A round was led by UK-based InReach Ventures, Lithuanian-based Practica Capital and New York-based investor FJ Labs, alongside several angel investors. Goodwin advised the investors and Cobalt advised Practica Capital. | USD8million | Lithuania | Here |
30-Dec | Sorainen; TGS Baltic | Sorainen helped renewable energy company Enerstena obtain a EUR 7 million loan from Lithuania's State Aid Fund for Business. TGS Baltic advised the fund on the deal. | EUR7million | Lithuania | Here |
17-Jan | Deloitte Legal; Kopec & Zaborowski | The Lithuanian office of Deloitte Legal participated in a multi-jurisdictional team advising Enva, a provider of recycling and specialist resource recovery solutions in the UK and Ireland, on its acquisition of SAR Recycling Ltd, which was advised by, among others, Warsaw's Kopec & Zaborowski law firm. | N/A | Lithuania; Poland | Here |
5-Mar | Gladei & Partners; Schoenherr | Schoenherr advised Fintur Holdings B.V. on its sale o Moldcell S.A., to CG Cell Technologies DAC. Gladei & Partners advised CG Technologies. | USD31.5million | Moldova | Here |
1-Jul | Gladei & Partners; Norton Rose Fulbright | Gladei & Partners and Norton Rose Fulbright assisted EBRD in the roll-over of its new TFP facility through Moldova-Agroindbank and Victoriabank. | EUR13million | Moldova | |
31-Aug | Gladei & Partners; K&L Gates; Tuca Zbarcea & Asociatii; Turcan Cazac | Gladei & Partners and K&L Gates advised the EBRD on the acquisition of a 25% stake in Vestmoldtransgaz, a gas transmission company operating the newly built Ungheni-Chisinau gas pipeline. Turcan Cazac advised Vestmoldtransgaz on the deal, while Tuca Zbarcea & Asociatii advised sellers TransGaz and its Moldovan subsidiary Eurotransgaz. | EUR20million | Moldova | Here |
26-Oct | Cobzac & Partners | Cobzac & Partners advised Mintos Finance Estonia on amending the pledge agreement between Mintos and Sebo Credit that allowed Sebo Credit to pledge part of its assets to another creditor to guarantee a new loan while Mintos Finance Estonia retains a first rank pledge of Sebo Credit's assets. | EUR30million | Moldova | |
17-Dec | CMS; Gladei & Partners; Schoenherr; Turcan Cazac | Gladei & Partners and Schoenherr assisted Vetropack AG with the acquisition of the Moldovan Glass Container Group companies. Turcan Cazac and CMS advised the sellers. | N/A | Moldova | |
21-Jan | Filip & Company; Freshfields; Osborne Clarke; Turcan Cazac; Vernon David & Associates | Filip & Company, Freshfields Bruckhaus Deringer, and Vernon David & Associates advised Banca Transilvania on the acquisition of Microinvest. Osborne Clarke and Turcan Cazac advised the sellers on the transaction. | N/A | Moldova; Romania | Here |
13-Aug | Hillmont Partners | Hillmont Partners obtained an award for interim measures for client Komaksavia Airport Invest Ltd in arbitration against the Republic of Moldova related to the concession agreement for the Chisinau International Airport. | N/A | Moldova; Ukraine | Here |
2-Nov | Harrisons | Harrisons advised Aer Rianta International on its five-year duty-free concession to run retail stores at the Tivat and Podgorica airports in Montenegro. | N/A | Montenegro | Here |
1-Feb | Harrisons | Harrisons advised the EBRD on Montenegrin aspects of a loan to NLB Bank Podgorica under the EBRD's Women in Business Programme. | EUR2million | Montenegro | |
1-Feb | Harrisons | Harrisons was engaged by Montenegro's electric power transmission system operator CGES to provide capacity and enforce a legal opinion in relation to a loan that CGES will received from KfW. | EUR20million | Montenegro | |
1-May | Clifford Chance; Harrisons | Harrisons, working alongside global advisor Clifford Chance, assisted Credit Suisse with a EUR 250 million facility agreement by and between Republic of Montenegro as the borrower, the International Bank for Reconstruction and Development as the guarantor, and Credit Suisse AG, London Branch, Crnogorska Komercijalna Banka AD Podgorica, and Societe Generale as the lenders. | EUR250million | Montenegro | |
1-Jun | Bird & Bird; Harrisons | Harrisons acted as Montenegrin legal counsel to the EBRD in relation to an unsecured loan to Elektroprivreda Crne Gore AD Niksic. Bird & Bird acted as English law counsel to the EBRD. | EUR50million | Montenegro | |
1-Oct | Harrisons; Norton Rose Fulbright | Harrisons, working alongside international advisor Norton Rose Fulbright, advised Export Development Canada on a loan to Montenegro for the purchase of Bell helicopters. | EUR3million | Montenegro | |
25-Dec | Harrisons | Harrisons advised the AFD (Agence Francaise de Developpement) on a credit line to the Investment and Development Fund of Montenegro (IDF) in order to enable IDF to strengthen its financings of environmental, efficacy, and renewable energy sources projects. | EUR50million | Montenegro | |
24-Apr | Polenak Law Firm | Polenak advised Eurolink Osiguruvanje AD Skopje on its sale of 100% shares to GRAWE. | N/A | North Macedonia | Here |
7-May | Polenak Law Firm | The Polenak Law Firm advised the EBRD in a EUR 2.5 million loan to Ohridska Banka AD Skopje under the Green Economy Financing Facility program, which is supported by the EU, Austria, and Western Balkans Investment Framework. | EUR2.5million | North Macedonia | Here |
24-Jul | Polenak Law Firm | Polenak advised the EBRD on a EUR 20 million loan to Sparkasse Bank Makedonija. | EUR20million | North Macedonia | Here |
31-Jul | Law Office Karmen Rebesco; Polenak Law Firm | The Polenak Law Firm advised NLB Bank Skopje as mandated lead arranger, agent, and lender on a EUR 72 million syndicated loan to East Gate to finance the construction of the East Gate Mall in Skopje. Law Office of Karmen Rebesco prepared the LMA finance documents and advised NLB dd. on the deal. East Gate was advised by solo practitioner Zeqir Zeqiri. | EUR72million | North Macedonia | Here |
5-Aug | ODI Law | ODI Law advised FLO Magazacilik ve Pazarlama A.S on the opening of stores in Skopje and Tetovo. | N/A | North Macedonia | Here |
5-Aug | ODI Law | ODI Law helped Exor N.V. obtain Macedonian merger clearance for its EUR 102.4 million acquisition of GEDi Gruppo Editoriale S.p.A. from CIR SpA. | EUR102.4million | North Macedonia | Here |
6-Aug | ODI Law | ODI helped Nova Ljubljanska Banka obtain Macedonian merger clearance for the acquisition of 83.23% of the ordinary shareholding in Komercijalna Banka a.d. Beograd. | N/A | North Macedonia | Here |
1-Sep | Baker & McKenzie; Karanovic & Partners | Karanovic & Partners, working with international counsel Baker McKenzie, advised the Giesecke & Devrient Group on its acquisition of a shareholding interest in the Netcetera Group AG, including its subsidiary in North Macedonia. | N/A | North Macedonia | |
1-Jan | Wardynski & Partners | Wardynski & Partners advised CMC Poland sp. z o.o. on its acquisition of all shares in Ecosteel sp. z o.o. from a group of private individuals. | N/A | Poland | |
2-Jan | Mrowiec Fialek & Partners | Mrowiec Fialek and Partners advised OCRK Sp. z o.o., a Polish portfolio company of Innova Capital, on the acquisition of a majority stake in Marcos Bis from unnamed sellers. | N/A | Poland | Here |
2-Jan | CMS | CMS advised Allianz Real Estate and Curzon Capital Partners III, L.P. on the sale of the Warsaw Financial Center in Warsaw's financial district to the Czech Republic's CPI Property Group. | N/A | Poland | Here |
2-Jan | Dentons; Greenberg Traurig | Dentons advised commercial real estate investor and developer Globe Trade Centre on its sale of shares in GTC Neptune Gdansk Sp. z o.o. - the owner of the Neptun Office Center in Gdansk. Greenberg Traurig advised the unnamed buyers. | N/A | Poland | Here |
6-Jan | DLA Piper; WBW Weremczuk Bobel & Wspolnicy | DLA Piper advised Resource Partners on its acquisition of a majority stake in Maced, a family-owned dog treats and snacks producer in Polanow, Poland. Maced was advised by WBW Weremczuk, Bobel & Wspolnicy. | N/A | Poland | Here |
6-Jan | White & Case | White & Case advised P4, the operator of Polish mobile network Play, on the launch of a bond issue program with a total nominal value of PLN 2 billion, as well as on the first issuance under the program of unsecured bearer bonds with a total nominal value of PLN 750 million. | PLN2billion | Poland | Here |
7-Jan | Gessel; Kasprzyk & Wojdan | Gessel advised BNP Paribas Bank Polska S.A. on its unspecified participation in Dafo Plastics S.A.'s recent financing round. Dafo Plastics was advised by Kasprzyk & Wojdan. | N/A | Poland | Here |
7-Jan | Czabanski & Galuszynski | Czabanski & Galuszynski advised Bank Gospodarstwa Krajowego on its loan of almost PLN 50 million to an unidentified special purpose vehicle to finance the costs of the construction of a warehouse complex in Poland. | PLN50million | Poland | Here |
13-Jan | Noerr; White & Case | Noerr advised TAG Immobilion on the acquisition of Polish real estate developer Vantage Development S.A. White & Case advised Vantage Development. | EUR131million | Poland | |
15-Jan | CMS; DZP Domanski Zakrzewski Palinka | CMS advised Poland's Local Government Investment Fund on its acquisition of 45% shares in Tarnobrzeskie Wodoci_gi sp. z o.o., a water supply company in Tarnobrzeg, Poland. Tarnobrzeskie Wodociagi and the Municipality of Tarnobrzeg were advised by Domanski Zakrzewski Palinka. | N/A | Poland | Here |
16-Jan | Orrick; SSW Pragmatic Solutions | Orrick and SSW Pragmatic Solutions advised Commercial Metals Company Poland on the completion of a ten-year financial (synthetic) power purchase agreement with renewable energy generator Statkraft. | N/A | Poland | |
17-Jan | Act (BSWW) | Act BSWW advised the Buma Group on the construction of the Wadowicka 3 real estate project in Krakow. | N/A | Poland | Here |
17-Jan | Linklaters | Linklaters advised Glamox AS, a Triton portfolio company, on its successful public tender offer to acquire 98.21% of the shares of Polish lighting solution provider ES-System. | N/A | Poland | Here |
17-Jan | Linklaters | Linklaters advised Resi4Rent on the acquisition of an apartment building in Wroclaw, Poland from Echo Investment. The financing of the building's construction was provided by a consortium led by Bank Pekao. | N/A | Poland | Here |
17-Jan | Linklaters | Linklaters advised UBM Development AGon the forward sale of hotel properties in Krakow and Katowice to Union Investment Institutional Property GmbH. | N/A | Poland | Here |
17-Jan | Bird & Bird | Bird & Bird advised Bank of China Luxembourg S.A, Poland and Luxembourg branches, on financing worth over EUR 120 million provided to two unnamed entities. | EUR120million | Poland | Here |
17-Jan | Allen & Overy; Gide Loyrette Nouel | Gide Loyrette Nouel advised KGHM Polska Miedz S.A. on a December 20, 2019 credit facility agreement in the amount of USD 1.5 billion with a consortium of banks including Bank Polska Kasa Opieki, Powszechna Kasa Oszczednosci Bank Polski, Intesa Sanpaolo, and Santander Bank Polska. The banks were advised by Allen & Overy. | USD1.5billion | Poland | Here |
20-Jan | Clifford Chance | Clifford Chance advised a consortium of Bank Pekao, PKO BP, Santander Bank Polska, and BNP Paribas Bank Polska on LPP S.A.'s bond issue program of up to PLN 300 million. | PLN300million | Poland | Here |
21-Jan | DLA Piper | DLA Piper advised FIZAN Foreign Expansion Fund on its investment in PGM, a Texas firm specializing in the treatment of used automotive and industrial catalytic converters. | N/A | Poland | Here |
21-Jan | DZP Domanski Zakrzewski Palinka | Domanski Zakrzewski Palinka advised OGP Gaz-System S.A. on a project involving the creation of a new gas supply corridor on the European market. | N/A | Poland | Here |
21-Jan | DWF; WKB Wiercinski Kwiecinski Baehr | DWF advised the H.I.G. Capital private equity fund on its acquisition of 100% of shares in Meyra Group S.A. from the Avallon and Euro Choice IV funds. WKB Wiercinski Kwiecinski Baehr advised the sellers. | N/A | Poland | |
21-Jan | Eversheds Sutherland | Wierzbowski Eversheds Sutherland advised ELMO on the sale of an organized part of its enterprise to Solutions 30 Holding. | PLN60million | Poland | Here |
23-Jan | DLA Piper | DLA Piper advised FIZAN Foreign Expansion Fund on the acquisition by its Recat subsidiary of a minority block of shares in Tesla Recycling from the Elemental Holding group. Elemental was advised by solo practitioner Maria Janicka. | N/A | Poland | Here |
24-Jan | Gessel | Gessel advised Avallon on the acquisition of a majority stake in Clovin S.A. | N/A | Poland | Here |
24-Jan | Jankowski & Stroinski; Kondracki Celej; Studnicki, Pleszka, Cwiakalski, Gorski | SPCG advised BNP Paribas on its investment, made with Alior Bank and PKO Bank Polski and in agreement with existing investors Innovation Nest and Black Pearls, in Autenti, a Polish Fintech platform for paperless electronic contract signing and digital document circulation. PKO was advised by Jankowski & Stroinski and Alior Bank by Kondracki Celej. | PLN17million | Poland | Here |
27-Jan | Mrowiec Fialek & Partners | Mrowiec Fialek and Partners helped Lime Access sp. z o.o. find an investor and execute an investment agreement. | N/A | Poland | Here |
27-Jan | Allen & Overy; Dentons; Studnicki, Pleszka, Cwiakalski, Gorski | Dentons and Studnicki Pleszka, Cwiakalski, Gorski advised French renewable energy producer Akuo Energy on financing it received for the construction of three wind farms from the Mirova Eurofideme 4 fund and a consortium of BNP Paribas Bank Polska, Commerzbank, and mBank. The banks were advised by Allen & Overy. | N/A | Poland | Here |
28-Jan | Dentons; Linklaters | Linklaters advised Chariot Group B.V. on the sale of DIY stores leased by OBI located in Gdansk and Lodz to a subsidiary of Marr Holdings, a company from the Republic of South Africa. Dentons advised the buyers. | N/A | Poland | Here |
28-Jan | Kochanski & Partners | Kochanski & Partners advised Visa Inc. on its launch of open banking services in Poland. | N/A | Poland | Here |
28-Jan | DLA Piper; Greenberg Traurig | DLA Piper advised asset management company KGAL Group on its purchase of the Prosta Office Center in Warsaw from Prosta Investments. Greenberg Traurig advised the sellers. | N/A | Poland | Here |
28-Jan | Dentons | Dentons advised Erste Group Bank AG and mBank S.A. on refinancing the acquisition of Polish solar projects with a capacity of 46 MW granted to a project company controlled by Aberdeen Standard Investments's fund. | N/A | Poland | Here |
28-Jan | Dorsey & Whitney; Fieldfisher; Wardynski & Partners | Wardynski & Partners, working alongside Fieldfisher, advised Descartes Systems UK Limited on its acquisition of Peoplevox Ltd. Dorsey & Whitney advised the seller. | N/A | Poland | |
29-Jan | DZP Domanski Zakrzewski Palinka | Domanski Zakrzewski Palinka advised the Ingka Group on a merger of its IKEA Retail and IKEA Property Poland subsidiaries in Poland. | N/A | Poland | Here |
29-Jan | Greenberg Traurig; Rymarz Zdort | Greenberg Traurig advised Madison International Realty on its acquisition of a 46.5% stake in European Logistics Investment, which holds a Polish real estate warehouse portfolio valued at approximately EUR 500 million, from its majority owner Redefine Properties Limited. Rymarz Zdort advised Redefine on the transaction. | N/A | Poland | Here |
29-Jan | Eversheds Sutherland; Ignition Law | Eversheds Sutherland advised Cogito Capital Partners on its investment in London-based Applica.AI ltd and its subsidiary Applica.AI sp.z.o.o., a software company and a developer of AI-based robotic text automation platform. Applica was advised by Ignition Law. | N/A | Poland | Here |
29-Jan | DLA Piper; Gessel | Gessel advised Polish Enterprise Fund VII, a private equity fund managed by Enterprise Investors, on the sale of Danwood Holding to GS Engineering & Construction. | EUR140million | Poland | Here |
30-Jan | Kondrat & Partners | Kondrat & Partners successfully represented the interests of the Warsaw School of Economics in a ten-year long dispute with the International Olympic Committee. | N/A | Poland | Here |
30-Jan | Mrowiec Fialek & Partners | Mrowiec Fialek and Partners advised Centrum Rozliczen Elektronicznych Polskie ePlatnosci S.A., a portfolio company of Innova Capital, on the acquisition of Poznan-based TopCard. | N/A | Poland | Here |
30-Jan | Noerr; White & Case | White & Case advised the Polish Aviation Group, which owns LOT Polish Airlines, on the acquisition of Germany's Condor Flugdienst GmbH. The sellers, UK's Thomas Cook, were advised by Noerr. | N/A | Poland | Here |
30-Jan | Kochanski & Partners | Kochanski & Partners helped Global Primex obtain clearance from the Polish Financial Supervision Authority to introduce the Vload eVoucher within the European Union. | N/A | Poland | Here |
30-Jan | Jacek Kosinski Adwokaci i Radcowie Prawni | Jacek Kosinski Adwokaci i Radcowie Prawni helped PGE Baltica obtain environmental permits to construct two offshore wind farms from the Regional Director for Environmental Protection in Gdansk. | PLN30billion | Poland | Here |
31-Jan | DLK Legal | DLK Legal advised Nest Bank S.A. on the launch of Nest Bank API - a project in which the bank provides FinTech firms and other institutions with an interface for integrating their services with its own. | N/A | Poland | Here |
31-Jan | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Venture Capital fund Cofounder Zone on its acquisition of an undefined stake in Ekobilet S.A., the owner of a technology platform for selling tickets for artistic and sporting events. | N/A | Poland | Here |
31-Jan | Dentons; Penteris | Penteris advised Apollo Rida on the acquisition of the Equal Business Park in Krakow from Cavatina Holding. Dentons advised the sellers. | N/A | Poland | Here |
31-Jan | DLA Piper | DLA Piper advised OEX on the buy-back of its shares. | PLN8million | Poland | Here |
31-Jan | Paul Hastings; WKB Wiercinski Kwiecinski Baehr | WKB advised the Intel Corporation on Polish aspects of its acquisition of Habana Labs, an Israeli company specializing in the design of processors for machine learning and artificial intelligence applications. Paul Hastings was global counsel to the Intel Corporation on the deal. | USD2billion | Poland | Here |
1-Feb | CMS; Noerr | Noerr advised Globe Trade Centre on the refinancing of the Galeria Jurajska shopping center in Poland by Erste Group Bank AG and Raiffeisenlandesbank Niederosterreich-Wien. CMS advised the lenders. | EUR130million | Poland | |
4-Feb | Czabanski & Galuszynski | Poland's Czabanski & Galuszynski law firm represented the AXA Association pro bonoin an unspecified dispute before Administrative courts. | N/A | Poland | Here |
4-Feb | Greenberg Traurig | Greenberg Traurig advised Wood & Co. as the sole global coordinator on an accelerated book-building process acquisition of 13.3% shares in Ten Square Games S.A. from its management board members Maciej Popowicz and Arkadiusz Pernal. | PLN220million | Poland | Here |
5-Feb | DLA Piper; Domanski Zakrzewski Palinka | DLA Piper advised Polish family-owned investment firm TDJ on its acquisition of a controlling 83% stake in Teamtechnik Production Technology, a company specializing in the design and manufacture of intelligent production lines for the automotive industry. Teamtechnik was advised by Domanski Zakrzewski Palinka. | N/A | Poland | Here |
6-Feb | Kochanski & Partners | Kochanski & Partners advised Formaster S.A. on its merger by absorption of subsidiaries Dafi Pro S.A. and Dafi Market S.A.. | N/A | Poland | Here |
7-Feb | Dentons | Dentons helped Toshiba Carrier Corporation establish its first European manufacturing site in Poland. | N/A | Poland | Here |
7-Feb | Greenberg Traurig; Linklaters | Greenberg Traurig advised Tritax EuroBox on its acquisition of Central Logistics Investment from Griffin Real Estate, which was acting on behalf of Redefine Properties. Linklaters advised the sellers on the deal. | N/A | Poland | Here |
7-Feb | Radzikowski, Szubielska I Wspolnicy; SSW Pragmatic Solutions | SSW Pragmatic Solutions advised White Stone Development on a loan it received from Santander Bank Polska. Radzikowski, Szubielska I Wspolnicy reportedly advised Santander Bank Polska. | N/A | Poland | Here |
7-Feb | CMS | CMS advised the Partners Group on its acquisition of a majority share of the VSB Group. | EUR1.3billion | Poland | Here |
10-Feb | Clifford Chance; White & Case | Clifford Chance advised INEA, an open-access fiber-optic network operator in Poland, on additional financing procured from a consortium of Bank Pekao S.A., Credit Agricole Bank Polska S.A., Credit Agricole Corporate and Investment Bank, EBRD, ING Bank Slaski S.A., PKO BP S.A., BNP Paribas Bank Polska S.A., and PZU Fizan BIS 1. White & Case advised the lenders. | PLN400million | Poland | Here |
11-Feb | Eversheds Sutherland | Eversheds Sutherland Wierzbowski is advising the Polish Ministry of Finance and Polish Financial Supervision Authority on a project titled "On the Road to Financial Inclusion and Innovation," which is designed to establish a legal and technological framework for developing the FinTech and SupTech sector in Poland. The project also involves the EBRD, among others. | N/A | Poland | Here |
11-Feb | Eversheds Sutherland; WKB Wiercinski Kwiecinski Baehr | Eversheds Sutherland Wierzbowski advised IGT Global Services on the sale of 100% of the shares of BillBird to Centrum Rozliczen Elektronicznych Polskie ePlatnosci. Wiercinski, Kwiecinski, Baehr advised the buyers on the deal. | N/A | Poland | Here |
12-Feb | Allen & Overy; DLA Piper; Greenberg Traurig; Norton Rose Fulbright; Rymarz Zdort | Norton Rose Fulbright advised the banks on financing provided to Vectra S.A. for its acquisition of Multimedia Polska S.A. Vectra was advised by Rymarz Zdort. Multimedia Polska was advised by Allen & Overy, while DLA Piper advised the shareholders of Multimedia Polska. Multimedia Polska's creditors were advised by Greenberg Traurig. | N/A | Poland | Here |
12-Feb | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised SkinWallet on its receipt of PLN 3.4 million in financing from multiple unidentified investors. | PLN3.4million | Poland | Here |
13-Feb | CMS; Solivan Pontes; Studnicki, Pleszka, Cwiakalski, Gorski | CMS advised MEAG, a German renewable industry investor, on its acquisition of a 21 MW wind farm project located in Zary, in Western Poland, from Sweden's OX2 Wind International AB. The sellers were advised by Solivan and Studnicki, Pleszka, Cwiakalski, Gorski. | N/A | Poland | Here |
13-Feb | Deloitte Legal; Kancelaria Kurek Wojcik; Schoenherr | Schoenher and Kancelaria Kurek Wojcik advised Europejski Fundusz Leasingowy SAÊ on its acquisition of a 70% stake in Hama Polska Sp. z o.o. Deloitte Legal advised the sellers. | N/A | Poland | |
13-Feb | Greenberg Traurig; Linklaters | Greenberg Traurig advised Union Investment on a preliminary agreement to acquire planned hotel properties in Katowice (the Hotel Mercure) and Krakow (the Hotel Ibis Styles) from UBM Development. Linklaters advised UBM Development on the transaction. | EUR86million | Poland | Here |
14-Feb | Balicki Czekanski Gryglewski Lewczuk; SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Unilink S.A. on its acquisition of a majority stake in Damo Ubezpieczenia. The sellers were advised by BCGL. | N/A | Poland | Here |
17-Feb | Decisive Worldwide Szmigiel Papros Gregorczyk | Decisive Worldwide advised the ENEL MED group on its lease of medical clinics in the Centrum Zana in Gdansk and in the React building in Lodz. | N/A | Poland | Here |
18-Feb | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised the owner of Kospel S.A. on the sale of the company to the Viessmann Group. | N/A | Poland | Here |
18-Feb | Kondrat & Partners | Kondrat & Partners successfully represented KA sp. z o.o. in a dispute with Poland's Chief Pharmaceutical Inspectorate in Warsaw regarding KA's preparation of homeopathic medicines on commission for another pharmacy. | N/A | Poland | Here |
19-Feb | Act (BSWW) | Act BSWW advised Adventum International on the acquisition of the Katowice Business Point building in Katowice. | N/A | Poland | Here |
19-Feb | Greenberg Traurig | Greenberg Traurig advised Cyfrowy Polsat on the issuance of Series C green bonds with an aggregate nominal value of PLN 1 billion. | PLN1billion | Poland | Here |
20-Feb | Act Legal (BSWW) | Act BSWW advised MK Holding Sarl on a joint venture with a company in theDeA Capital Group, an Italian investment group focusing on real estate and equity investments. | N/A | Poland | Here |
20-Feb | Argon Legal; Decisive Worldwide Szmigiel Papros Gregorczyk | Decisive Worldwide advised Orsted Polska on its lease of office space in Warsaw's Varso Space Complex from CHM 1, which was advised by Argon Legal. | N/A | Poland | Here |
20-Feb | Jara Drapala & Partners; WKB Wiercinski Kwiecinski Baehr | Jara Drapala & Partners advised Bas Lease B.V. on cross-border financing granted to Boekestijn Transport Holding B.V. for its acquisition of Baltic Trans sp. z o.o. from ECS Corporate N.V. WKB advised Boekestijn Transport on both the financing and the acquisition. | N/A | Poland | Here |
20-Feb | Kancelarii Kulicki; Kondracki Celej; Orrick | Orrick and Kondracki Celej advised Dogmates (trading as Butternut Box) on its investment into the USD 400,000 financing of PsiBufet, a Poland-based home-made dog food manufacturer. Kancelarii Kulicki advised PsiBufet. | USD400000 | Poland | |
21-Feb | Gide Loyrette Nouel; Wardynski & Partners | Gide advised B&B Hotels Polska on a cooperation agreement with Covivio and on the sale and leaseback of three hotels. Covivio was advised by Wardynski & Partners. | N/A | Poland | Here |
21-Feb | Linklaters | Linklaters advised Panattoni Europe on negotiating the terms of a lease of nearly 6,500 square meters of space in the Panattoni Park Gorzow logistics park to Omnipack. | N/A | Poland | Here |
24-Feb | Dentons; Kwasnicki, Wrobel & Partners; Rymarz Zdort | Rymarz Zdort advised a joint venture of a fund managed by the Real Estate Group of Ares Management Corporation and Griffin Real Estate on its acquisition of 98.04% of the shares in residential property developer Murapol. RKKW advised Murapol on the deal, and Dentons advised the Cavatina real estate company on the sale of its stake in Murapol. | N/A | Poland | Here |
24-Feb | Clifford Chance; Greenberg Traurig | Greenberg Traurig advised REINO RF CEE Real Estate, a Luxembourg-based fund created by REINO Capital and Australia's CorVal, on its preliminary agreement to acquire the entire BUMA Group real estate portfolio. Clifford Chance advised the BUMA group. | PLN1.3billion | Poland | Here |
25-Feb | Clifford Chance; White & Case | White & Case advised the Polish Ministry of Finance on its issuance of EUR 1.5 billion five-year notes. Clifford Chance advised the consortium of banks that arranged the issuance, which included BNP Paribas, Commerzbank, ING, JP Morgan, PKO BP and Santander. | EUR1.5billion | Poland | Here |
25-Feb | Linklaters | Linklaters advised Bain Capital Credit on a joint venture with real estate investment manager Corestate that resulted in Corestate's approximately EUR 73 million acquisition of the first Micro Living properties in Gdansk and Krakow for Bain Capital Credit. | EUR73million | Poland | Here |
25-Feb | Greenberg Traurig; Hogan Lovells | Hogan Lovells advised the Akiem Group on the acquisition of Macquarie Europe Rail's rolling stock leasing business, including 137 locomotives, 110 carriages, and 46 trains. The seller was advised by Greenberg Traurig. | N/A | Poland | |
26-Feb | White & Case | White & Case advised the European Investment Fund on a synthetic securitization project originated by Europejski Fundusz Leasingowy, a leasing company in the Credit Agricole Group. | EUR490million | Poland | Here |
26-Feb | Mrowiec Fialek & Partners | Mrowiec Fialek and Partners advised Wroclaw-based Work Service S.A. on an investment agreement with Gi International. | PLN210.2million | Poland | Here |
4-Mar | Clifford Chance; Gessel; Noerr | Noerr advised HKM Beteiligungs GmbH on the sale of Gratka sp. z o.o.to Ringier Axel Springer Media AG, which was advised by Clifford Chance. The deal also included a related transaction in which Ringier Axel Springer Media acquired MZN Property SA via tender offer. Gessel advised MZN minority shareholder Alterium Holding Sp. z o. o., on that deal. | N/A | Poland | Here |
4-Mar | Andersen Global | Andersen Tax & Legal helped the FCA Group alter the Polish structure of the banking arm of the FCA Bank, a joint venture of Fiat Chrysler Automobiles and Credit Agricole Consumer Finance. | N/A | Poland | Here |
5-Mar | DLA Piper; Olesinski & Wspolnicy | DLA Piper advised Allegro on its acquisition of FinAi from its founders and from the Fidiasz FIZ investment fund. Olesinski & Wspolnicy advised Fidiasz on the deal. | N/A | Poland | Here |
5-Mar | Benvalor; Jacek Kosinski Adwokaci I Radcowie Prawni; LXA | Jacek Kosinski Adwokaci i Radcowie Prawni, working with the Netherlands' Benvalor law firm, advised Shibumi, a Dubai-based venture capital company, on an unspecified investment in Sustonable, a sustainable building materials company which produces composite stone surfaces. Sustonable was advised by LXA. | N/A | Poland | |
5-Mar | Dentons; DLA Piper | DLA Piper advised Santander Bank Polska, BNP Paribas Bank Polska, PKO Bank Polski, and Bank Pekao on a loan to HB Reavis for the development of the Forest office campus in Warsaw. Dentons advised HB Reavis on the deal. | EUR162million | Poland | |
6-Mar | Hogan Lovells | Hogan Lovells advised German real estate investment funds management company Patrizia Frankfurt on tax aspects of its sale of an office building in Warsaw. | N/A | Poland | Here |
6-Mar | CMS | CMS advised MZN Property S.A. and some of its shareholders on the acquisition of an unnamed strategic investor. | N/A | Poland | Here |
9-Mar | Allen & Overy; Wolf Theiss | Wolf Theiss advised Marvipol Development and PG Dutch Holding I on the sale by their joint venture special purpose vehicles of development plots in Warsaw and Michalowice to LaSalle Investment Management KVG. Allen & Overy advised the buyer on the deal. | EUR29.6million | Poland | Here |
10-Mar | De Brauw Blackstone Westbroek; Dechert; Homburger; McDermott Will & Emery; Paul, Weiss, Rifkind, Wharton & Garrison; Schoenherr; Torys | Schoenherr, De Brauw Blackstone Westbroek, and Paul Weiss Rifkind Wharton & Garrison advised Apollo Global Management, LLC on its acquisition of Covis Pharma BV from a group of sellers, including Cerberus Capital Management, L.P. and Princeton BioPharma Capital Partners LLC. Dechert, McDermott Will & Emery, and Torys advised Covis Pharma, as the target of the deal. Dechert and Homburger advised the sellers on the deal. | N/A | Poland | |
10-Mar | Eversheds Sutherland | Eversheds Sutherland advised EEC Magenta on its investment of PLN 10 million in Sinterit Sp. z o.o. | PLN10million | Poland | Here |
11-Mar | Gessel | Gessel successfully represented Polish citizen Wladyslaw Frasyniuk against charges he violated the physical integrity of police officers. | N/A | Poland | Here |
11-Mar | SSW Pragmatic Solutions | SSW Pragmatic Solutions helped Games Operators obtain the approval of the Polish Financial Supervision Authority for its prospectus. | N/A | Poland | Here |
12-Mar | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised V&P sp. z o.o. on the company's investment policy and investment strategy and represented V&P in proceedings before the Polish Financial Supervisory Authority, resulting in the company's successful registration as an Alternative Investment Funds Manager. | N/A | Poland | Here |
13-Mar | DLA Piper | DLA Piper advised Polnord, a residential development company in Poland, on its EUR 31.7 million public offering. | EUR31.7million | Poland | Here |
18-Mar | Dentons; Greenberg Traurig | Greenberg Traurig advised Heitman on the sale of the Marynarska Business Park A-class office building complex in Warsaw to Benson Elliot. Dentons advised the buyers on the deal. | N/A | Poland | Here |
18-Mar | Soltysinski Kawecki & Szlezak | Soltysinski Kawecki & Slezak successfully represented the interests of Polimex-Mostostal before the Court of Appeal in Katowice, Poland, in a dispute against the City of Katowice. | PLN40.4million | Poland | Here |
19-Mar | Act Legal (BSWW); Clifford Chance; Domanski Zakrzewski Palinka; Oles & Rodzynkiewicz | Act BSWW advised the Management Boards of the Buma Group companies on the sale of its real estate assets to Reino RF CEE Real Estate, a joint venture established by Reino Capital and RF CorVal International Holdings Limited. Clifford Chance, Domanski Zakrzewski Palinka, and Oles & Rodzeynkiewicz advised the sellers on the deal, while Greenberg Traurig advised the buyers. | N/A | Poland | Here |
19-Mar | Rymarz Zdort; White & Case | Rymarz Zdort advised Innova Capital and OPTeam on the sale of Centrum Rozliczen Elektronicznych Polskie ePlatnosci to Rementi Investments. White & Case advised Rementi Investments on the transaction. | N/A | Poland | Here |
19-Mar | Moore Blatch; Zieba & Partners | Zieba & Partners advised Gamma Communications on Polish Law aspects of its acquisition of Exactive Holdings Limited. England's Moore Blatch advised Exactive. | N/A | Poland | Here |
19-Mar | Domanski Zakrzewski Palinka | Domanski Zakrzewski Palinka advised TECS Telecommunication & e-Commerce Solutions GmbH on a tender for the implementation of a project for handling cashless payments and settling transactions in the Electronic Toll Collection System that was conducted by Poland's General Inspectorate of Road Transport. | N/A | Poland | Here |
19-Mar | Studnicki, Pleszka, Cwiakalski, Gorski | SPCG persuaded the District Court in Gdansk to rule in favor of its client, Talia Sp. z o.o., in a claim against Polska Energia - First Kompania Handlowa sp. z o. o. | N/A | Poland | Here |
23-Mar | Dentons; Penteris | Penteris advised Immofinanz on its sale of the Equator I office building in Warsaw to CPI Property Group. Dentons advised the buyers on the deal. | N/A | Poland | Here |
23-Mar | Dentons | Dentons helped Pro Patria Electronics win a public contract bid to deliver 104 battlefield reconnaissance radar sets in Poland. | N/A | Poland | Here |
23-Mar | Thommessen Law Firm; Zieba & Partners | Zieba & Partners advised EG A/S on its acquisition of Holte AS. Norway's Thommessen Law advised the sellers on the deal. | N/A | Poland | Here |
24-Mar | SMM Legal | SMM helped Energa-Obrot S.A. settle its seventh and final dispute in a series of conflicts involving green certificates for wind farms with unnamed business partners. | N/A | Poland | Here |
27-Mar | Dentons; DLA Piper | DLA Piper advised Elite Partners Capital on the purchase of a five-warehouse logistics park covering more than 200,000 square meters in the south-west of Warsaw, from P3 Mszczonow. Dentons advised the sellers. | N/A | Poland | Here |
30-Mar | Dentons; Greenberg Traurig | Greenberg Traurig advised Deka Immobilien on the acquisition of the Generation Park Z office building from Skanska. Dentons advised Skanska. | N/A | Poland | Here |
2-Apr | Domanski Zakrzewski Palinka | Domanski Zakrzewski Palinka and solo practitioner Marzena Juskiewicz successfully represented the City of Krakow Road Administration before Poland's National Appeal Chamber regarding a PPP project involving the design, construction, and operation of part of a tramway. | N/A | Poland | Here |
3-Apr | Radzikowski, Szubielska i Wspolnicy | Radzikowski, Szubielska i Wspolnicy advised ZPUE on a PLN loan of 180 million it received from, among others, Santander Bank, Citihandlowy-Bank Handlowy w Warszawie, and ING Bank Slaski. | PLN180million | Poland | Here |
3-Apr | Dentons | Dentons advised CPI Property Group on its acquisition of the Moniuszki 1A office building in Warsaw from Canadian investment fund Catalyst Capital. | EUR800million | Poland | Here |
9-Apr | Baker Mckenzie; Dentons | Dentons advised Hines Poland Sustainable Income Fund on the sale of a portfolio of six Polish distribution parks and the Nord Point office building in Warsaw to Chinese investor CGL Investment Holdings Corporation Limited. Baker McKenzie advised the buyers. | N/A | Poland | Here |
9-Apr | Clifford Chance; Linklaters | Clifford Chance advised a consortium of banks including Intesa Sanpaolo Oddzia_ w Polsce as lender and paying agent, Banca IMI, London Branch and China Construction Bank Oddzial w Polsce as mandated lead arrangers and bookrunners, and Banca IMI S.p.A. as facility agent on a PLN 500 million syndicated loan to Tauron Polska Energia. Linklaters advised Tauron Polska Energia. | PLN500million | Poland | Here |
14-Apr | Dentons | Dentons advised Savills Investment Management on its acquisition of the Leroy Merlin distribution center near Lodz from Invesco Real Estate. The purchase, which was valued at approximately EUR 71 million, was made on behalf of Korean institutional investors managed by Vestas Investment Management. | EUR71million | Poland | Here |
17-Apr | Greenberg Traurig; Linklaters | Greenberg Traurig advised IAD Investments on its acquisition of the company holding the D48 office building in the Mokotow district of Warsaw from Penta Real Estate. Linklaters advised the sellers on the deal. | N/A | Poland | Here |
20-Apr | Mrowiec Fialek & Partners | Mrowiec Fialek and Partners advised Yuniversal Development on the issuance of PLN 4 million in corporate bonds. | PLN4million | Poland | Here |
21-Apr | Clifford Chance; Dentons; Kancelaria Kurek Wojcik | Dentons advised a fund managed by GLL Real Estate Partners on the acquisition of a logistic center in Kokotow, Poland, from a joint venture of 7R S.A. and Hillwood Polska. KKW advised 7R and Clifford Chance advised Hillwood Polska on the deal. | N/A | Poland | Here |
22-Apr | CMS; Gide Loyrette Nouel | CMS advised Amundi Real Estate on its acquisition of Nowogrodzka Square, a Class A office and retail building in Warsaw, from Polish property developer Yareal. Gide Loyrette Nouel advised Yareal. | N/A | Poland | Here |
22-Apr | Rymarz Zdort | Rymarz Zdort advised PSP, the operator of the BLIK mobile payment system, on the addition of Mastercard as an investor and the start of commercial collaboration between it and PSP. | N/A | Poland | Here |
22-Apr | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Orlen Poludnie on its launch of a second generation bioethanol plant at its refinery in Jedlicze, Poland. | N/A | Poland | Here |
23-Apr | DLA Piper; Rymarz Zdort | Rymarz Zdort advised Cordia International on its PLN 229.4 million acquisition of a majority stake in Polnord S.A. DLA Piper advised Polnord on the deal. | PLN229.4million | Poland | Here |
24-Apr | SSW Pragmatic Solutions | SSW Pragmatic Solutions assisted Games Operators with its initial public offering and listing on the Warsaw Stock Exchange. | N/A | Poland | Here |
27-Apr | CMS | CMS advised Real Assets Advisers on its joint acquisition of 33% of Acciona Energia Internacional by AXA Real Asset and Acciona S.A. | N/A | Poland | Here |
27-Apr | White & Case | White & Case advised PKO Bank Polski on a tender offer to the holders of its EUR 750 million notes and USD 1 billion notes issued by its subsidiary, PKO Finance AB. | EUR1.2billion | Poland | Here |
28-Apr | Dentons; Rymarz Zdort | Dentons advised ING Bank Slaski on a multimillion acquisition financing and refinancing of a portfolio of Polish solar projects with an aggregate capacity of 45 MW. The financing was granted to a project company controlled by a fund managed by Aberdeen Standard Investments, which was advised by Rymarz Zdort. | N/A | Poland | Here |
28-Apr | Jacek Kosinski Adwokaci i Radcowie Prawni | Jacek Kosinski Adwokaci i Radcowie Prawni advised Dubai-based VC Shibumi International on its investment in Hustro, a Wroclaw-based company that operates in the construction sector. Hustro was advised by solo practitioner Maksymilian Imbirski. | N/A | Poland | Here |
29-Apr | Fieldfisher; RJPartners; Wardynski & Partners | Wardynski & Partners, working alongside Italian counsel Fieldfisher, advised Cefla s.c. on its acquisition of 51% of the shares in Stern Weber Polska sp. z o.o. The sellers were assisted by RJPartners. | N/A | Poland | |
30-Apr | Bech-Bruun; Link Legal; Soltysinski Kawecki & Szlezak; Wardynski & Partners; Wikborg Rein | Wardynski & Partners, working alongside Gorrissen Federspiel, advised Leica Geosystems (part of Hexagon) on its acquisition of the aerial mapping business of international consulting group COWI. COWI was assisted by Wikborg Rein, Bech-Bruun, SK&S Legal, and Link Legal. | N/A | Poland | |
30-Apr | Allen & Overy; Hogan Lovells | Hogan Lovells advised Metro Warszawskie Sp. z o. o. on credit facilities it obtained for new infrastructure and the purchase of new environment-friendly rolling stock, as well as on the negotiation of a new public service agreement. The financing in the amount of up to PLN 654 million will be provided by the European Investment Bank. Allen & Overy advised the lender. | PLN654million | Poland | |
1-May | Brockhuis Jurczak Prusak Sroka Nilsson; Radzikowski, Szubielska I Wspolnicy | BSJP advised European Energy, a Denmark-based constructor of wind and solar farms as well as large-scale green energy storage facilities, on an acquisition of a Polish wind farm investment project with a total nominal wind capacity of 48 MW. Radzikowski, Szubielska I Wspolnicy advised the seller | N/A | Poland | |
1-May | Brockhuis Jurczak Prusak Sroka Nilsson | On behalf of European Energy, a Denmark-based constructor of wind and solar farms as well as large-scale green energy storage facilities, BSJP negotiated the rights to the acquisition of a large-scale photovoltaic installation in Poland with a total nominal capacity of 150 MW. | N/A | Poland | |
1-May | Bech-Bruun; Kromann Reumer; Wardynski & Partners; White & Case | Wardynski & Partners, working alongside Kromann Reumert, advised the Orifarm Group pharmaceutical company on the acquisition of a portfolio of select over-the-counter and prescription pharmaceutical products from Takeda Pharmaceutical Company Limited. White & Case and Bech-Bruun advised the sellers. | USD670million | Poland | |
4-May | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Link4 TU S.A. on the implementation of a blockchain-based project that will allow the company to, in the firm's words, "meet the requirements set by the regulator in the area of providing clients with documents, and save costs through digitization." | N/A | Poland | Here |
5-May | CMS; Schoenherr | CMS advised PZ Cussons on the sale of LUKSJA, a Polish personal care cosmetics brand, to the Sarantis Group. Schoenherr advised Sarantis on the deal. | N/A | Poland | Here |
5-May | Greenberg Traurig; Noerr | Greenberg Traurig has advised the Polsat Group on its acquisition of Interia Group from Bauer Media Group. Noerr advised the sellers on the deal, which remains subject to regulatory approval. | N/A | Poland | Here |
5-May | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Zedra Malta Limited on the acquisition of Poland's Awans Corporate Services. | N/A | Poland | Here |
6-May | Domanski Zakrzewski Palinka | Domanski Zakrzewski Palinka advised Gas-System SA on a construction and assembly agreement with Saipem Limited regarding the laying of the Baltic Pipe intersystem gas pipeline on the bottom of the Baltic Sea and connecting the undersea part of the pipeline with onshore sections in Poland and Denmark. | N/A | Poland | Here |
6-May | Greenberg Traurig | Greenberg Traurig helped Zygmunt Solorz, the founder and majority shareholder of Grupa Polsat, purchase 200 thousand genetic tests to be used by all Ministry of Health laboratories in Poland to diagnose the coronavirus. | PLN16million | Poland | Here |
7-May | Rymarz Zdort | Rymarz Zdort advised Griffin Real Estate and European Logistics Investment BV on the acquisition of land and the construction of warehouses in the Polish communities of Ruda Slaska, Czeladz, and Torun, from Panattoni Development Europe. | N/A | Poland | Here |
8-May | Dentons; Wozniak Legal | Dentons advised the CPI Property Group on its acquisition of a 50.3% share in the ownership of the Chalubinskiego 8 office building in Warsaw from First Property Group. Wozniak Legal advised the sellers on the deal. | N/A | Poland | Here |
8-May | Marekwia & Plawny; Noerr | Noerr advised environmental service provider PreZero on its acquisition of 100% of the shares of Komart, a Polish provider of municipal and industrial waste management services. Marekwia & Plawny advised the unidentified sellers on the deal. | N/A | Poland | Here |
11-May | Greenberg Traurig | Greenberg Traurig advised CCC and its main shareholder on issuing and offering 13.7 million new shares. | PLN500million | Poland | Here |
14-May | SMM Legal | SMM Legal helped the Polish National Center for Research and Development launch the "Grand Challenge: Energy" project. | N/A | Poland | Here |
15-May | Kwasnicki, Wrobel & Partners | Kwasnicki Wrobel & Partners advised Lorentz Tech Limited on the acquisition of Cube ID, a Polish company specializing in identity management products. | N/A | Poland | Here |
15-May | Allen & Overy | Allen & Overy advised the Polish Development Fund on the implementation of Poland's "PFR Financial Shield for Small and Medium-Sized Enterprises" program that is designed to provide financial support for enterprises following the outbreak of the COVID-19 coronavirus pandemic. | N/A | Poland | Here |
18-May | Bird & Bird | Bird & Bird won the right to advise the Solidarity Transport Hub on its selection of key consultants for a new airport in Poland. | N/A | Poland | Here |
18-May | Gessel | Gessel advised Systexan SARL, a fund managed by Enterprise Investors, on its exit from X-Trade Brokers Dom Maklerski S.A., including its conducting a public offer in the form of accelerated book-building worth PLN 111.2 million. Global coordinators were PKO BP and Ipopema Securities. | PLN111.2million | Poland | Here |
22-May | Act (BSWW) | Act BSWW advised AFI Europe on a lease of 900 square meters of office space in the V.Offices complex in Krakow to BrainShare IT. | N/A | Poland | Here |
22-May | Clifford Chance; DWF | DWF advised Solaque Holding Ltd. on the sale of two wind farms in Poland to Fonnes sp. z o.o., a subsidiary of Taaleri Plc. Clifford Chance advised the buyers on the deal. | N/A | Poland | Here |
26-May | White & Case | White & Case advised Kenbourne Invest II and Tollerton Investments Limited on the PLN 700 million sale of shares in Play Communications. BofA Securities and Santander Bank Polska S.A. - Santander Biuro Maklerskie acted as joint global coordinators and joint bookrunners. | PLN700million | Poland | Here |
28-May | Dentons; Rymarz Zdort | Rymarz Zdort advised a company controlled by a fund managed by Aberdeen Standard Investments on the refinancing of one of its Polish photovoltaic portfolio with an aggregate capacity of 55 MW. Dentons advised Erste Group Bank AG and ING Bank Slaski S.A. on the refinancing. | N/A | Poland | Here |
29-May | BCGL; Gessel | BCGL advised mBank S.A. on financing granted to PGB Holdco and its subsidiaries for the development and start-up of biogas plant facilities. Gessel advised PGB Holdco on the deal. | N/A | Poland | Here |
4-Jun | Act (BSWW); Deloitte Legal | Act BSWW advised the Adventum International investment fund on the acquisition of a 17,000-square-meter office building in Wroclaw, Poland, from EFL Service SA,, which is controlled by Europejski Fundusz Leasingowy SA. Deloitte Legal advised the sellers on the deal. | N/A | Poland | Here |
4-Jun | CMS; Eversheds Sutherland | Eversheds Sutherland Wierzbowski advised the Lithuanian electricity transmission system operator on an agreement regarding the construction of the Harmony Link submarine cable between Lithuania and Poland. CMS advised Polish power transmission system operator PSE on the deal. | N/A | Poland | Here |
4-Jun | Allen & Overy; Ellex (Valiunas) | Ellex Valiunas advised Energy Solar Projekty sp.z o.o on its receipt of a EUR 36 million loan from the EIB and DNB Bank Polska. Allen & Overy advised DNB Bank Polska on the loan, which is designed for the development of a solar power plant project in Poland. | EUR36million | Poland | Here |
4-Jun | Baker Mckenzie; CMS; DLA Piper; White & Case | CMS advised Grupa Azoty Polyolefins on financing it received from Grupa Lotos SA and South Korea's Hyundai Engineering and Korea Overseas Infrastructure & Urban Development Corporation for the Police Polimery polypropylene project in Poland, as well as on the implementation of the project. Baker McKenzie advised Grupa Lotos and DLA Piper advised Hyundai and Korea Overseas Infrastructure & Urban Development on the deal. | USD1.20billion | Poland | Here |
5-Jun | Hogan Lovells; Linklaters | Linklaters advised Swedish real estate private equity firm NIAM on the sale of Silesia Business Park A and B in Katowice to the Philippine's ISOC Group, represented in Poland by Augusta Cracovia, which was advised by Hogan Lovells. | N/A | Poland | Here |
8-Jun | MGS Law | MGS Law advised Orange Poland on two Power Purchase Agreements concluded with German renewable energy projects developer WPD regardingÊwind farms WPD will operate in Jarocin (5 MW) and Krotoszyn (10 MW). | N/A | Poland | Here |
8-Jun | DWF | DWF advised Polish Enterprise Fund VIII, a private equity fund managed by Enterprise Investors, on an unspecified investment in the Vehis Group. | N/A | Poland | Here |
8-Jun | Dentons; Penteris | Dentons advised commercial real estate developer Cavatina Holding on the sale of three A-class office buildings in the Equal Business Park office complex in Krakow to a consortium managed by Apollo-Rida Poland. Penteris advised Apollo-Rida on the deal. | N/A | Poland | Here |
8-Jun | Rymarz Zdort | Rymarz Zdort advised funds controlled by Aberdeen Standard Investments on the acquisition of a portfolio of 130 photovoltaic plants with a total capacity of 122 MW from Poland's R. Power Group. | N/A | Poland | Here |
8-Jun | Gide Loyrette Nouel | The Warsaw office of Gide advised Archicom on its EUR 33.8 million sale of the City One office building in Wroclaw to an unnamed institutional investor. | EUR33.8million | Poland | Here |
8-Jun | Mrowiec Fialek & Partners | Mrowiec Fialek & Partners advised Polski Holding Nieruchomosci S.A. on the issuance of E series shares and on their admission to trading on the Warsaw Stock Exchange. | PLN4.2million | Poland | Here |
11-Jun | Gide Loyrette Nouel; White & Case | Gide Loyrette Nouel advised Sierra Gorda on its entrance into a credit facility agreement of USD 200 million with Bank Gospodarstwa Krajowego. Gide also advised corporate guarantors KGHM Polska Miedz S.A., Sumitomo Metal Mining Co. Ltd, and Sumitomo Corporation. White & Case advised Bank Gospodarstwa Krajowego on the deal. | EUR200million | Poland | Here |
15-Jun | Bird & Bird; SRC | Bird & Bird advised mBank on an unspecified financing and refinancing transaction related to the construction of 28 solar farms in northwestern Poland owned by seven SPVs belonging to Denmark's Nordic Solar. SRC advised Nordic Solar. | N/A | Poland | Here |
15-Jun | Jara Drapala & Partners | JDP helped a consortium composed of Intercor, Stecol, and Sinohydro to win a tender announced by PKP PLK S.A. and involving the construction of part of Rail Baltica, a railway corridor connecting Berlin, Warsaw, Kaunas, Riga, Tallinn and Helsinki. | PLN4.1billion | Poland | Here |
17-Jun | CK Legal; Decisive Worldwide Szmigiel Papros Gregorczyk | Decisive Worldwide Szmigiel Papros Gregorczyk advised Rengl Polska Sp. z o. o. on its acquisition of the assets of Krakow's Wenecja Advertising Agency. CK Legal advised the sellers on the deal. | N/A | Poland | Here |
18-Jun | Norton Rose Fulbright | Norton Rose Fulbright advised a consortium of Polish banks consisting of mBank S.A. and Santander Bank Polska S.A. in relation to the financing of R. Power's 121 MWp PV installations in Poland. | PLN350million | Poland | Here |
22-Jun | CMS; Rymarz Zdort | Rymarz Zdort advised a fund controlled by Aberdeen Standard Investments on its acquisition of a portfolio of 41 photovoltaic projects from Lithuania-based Green Genius. CMS advised Green Genius on the deal. | N/A | Poland | Here |
23-Jun | Gawronski & Partners | Gawronski & Partners advised Przedsiebiorstwo Wodociagow i Kanalizacji on the organization of a public procurement procedure for the construction of a pioneer nutrient recovery facility designed torecover phosphorus from reclaimed water in a sewage treatment plant in the Polish town of Cielcza. | N/A | Poland | Here |
23-Jun | Linklaters | Linklaters advised Polish Logistics LLP on the acquisition and financing of a logistics park in Piotrkow Trybunalski, near Lodz, from unnamed sellers. | N/A | Poland | Here |
23-Jun | Schnittker Moellmann Partners; SSW Pragmatic Solutions; Taylor Wessing | SSW Pragmatic Solutions, working with Germany's Schnittker Moellmann Partners, advised Polish private equity investor ARIA Private Equity on its investment in Inuru, a company providing electronic packaging solutions. Taylor Wessing advised Inuru on the transaction. | EUR2million | Poland | Here |
23-Jun | Dentons; Linklaters | Linklaters advised the EBRD and BNP Paribas Bank Polska on financing provided to five Polish special purpose vehicles owned by the French renewable energy developer and operator Qair and the French infrastructure fund RGreen Invest and advised BNP Paribas Bank Polska on financing provided to three Polish special purpose vehicles of the same portfolio, with the total financing to the portfolio amounting to approximately PLN 700 million. Dentons advised Qair on the deal. | PLN700million | Poland | Here |
24-Jun | CK Legal | CK Legal advised Selvita S.A. on its successfully allotment of 2.38 million of C series shares, raising EUR 20.6 million from investors. | EUR20.6million | Poland | Here |
26-Jun | Gessel | Gessel advised Anwim on its investment in a network of unmanned eMila service stations. | N/A | Poland | Here |
26-Jun | Arena Legal; Gessel; Lewczuk Lyszczarek I Wspolnicy | Gessel advised the Sunfish Partners fund on participating in an investment round, together with Chiratae Ventures and Joyance Partners, for Aether Biomedical. Lewczuk Lyszczarek I Wspolnicy advised Aether Biomedical on the deal, while Arena Legal had advised Chiratae Ventures and Joyance Partners. | N/A | Poland | Here |
26-Jun | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised CofounderZone, a venture capital fund managed by the state-owned PFR Ventures group, on its investment in Nethansa, a Polish startup offering the Clipperon system for automating logistics and sales processes on the Amazon platform. | N/A | Poland | Here |
26-Jun | DWF; Skils; WKB Wiercinski Kwiecinski Baehr | DWF advised the ESPF 4 fund managed by KGAL on the acquisition of two wind farms with a total capacity of 40 MW from the CEZ Group. WKB Wiercinski Kwiecinski Baehr and Skils advised CEZ on the deal. | N/A | Poland | Here |
26-Jun | Rymarz Zdort | Rymarz Zdort advised European Logistics Investment BV and Griffin Real Estate on the acquisition of land for the construction of a warehouse in Zabrze, Poland. | N/A | Poland | Here |
26-Jun | Gessel | Gessel advised Polish stem cell bank Polski Bank Komorki Macierzystych on its EUR 420,000 acquisition of 53% of the share capital of Milan-based Sorgente S.r.l. | EUR420000 | Poland | Here |
29-Jun | SSW Pragmatic Solutions | SSW Pragmatic Solutions helped Gaming Factory SA obtain approval for its prospectus from the Polish Financial Supervision Authority for a planned public offering and application for admission and introduction of shares to trading on the regulated market of the Warsaw Stock Exchange. | N/A | Poland | Here |
30-Jun | Hogan Lovells | Hogan Lovells advised Santander Leasing S.A. on legal and tax aspects of its synthetic securitization of a portfolio of lease receivables worth PLN 2 billion. As part of the transaction, the EIB Group will guarantee the mezzanine tranche in the amount of PLN 284 million and the senior tranche of PLN 1.7 billion. | PLN2billion | Poland | |
1-Jul | Allen & Overy; Gorrissen Federspiel; Wardynski & Partners | Wardynski & Partners and Gorrissen Federspiel advised the Salling Group on the acquisition of shares in Tesco. Allen & Overy advised Tesco. | N/A | Poland | Here |
1-Jul | Brockhuis Jurczak Prusak Sroka Nilsson; SSW Pragmatic Solutions | BSJP advised Germany's PNE on an acquisition of a Polish wind farm project with a total nominal wind capacity of 60 MW. SSW Pragmatic Solutions advised the seller. | N/A | Poland | |
1-Jul | Greenberg Traurig | Greenberg Traurig advised Panattoni Development Europe on a transaction related to the financing and planned development of a logistic park near Warsaw. | EUR132million | Poland | Here |
1-Jul | CMS; Dentons | CMS advised Bayerische Landesbank on financing to Pacifico Energy Partners for the construction of three wind farms with a total capacity of almost 52 MW. Dentons advised the borrower. | PLN366million | Poland | Here |
1-Jul | Brockhuis Jurczak Prusak Sroka Nilsson; Schoenherr | BSJP advised DB Schenker on a real estate acquisition and investment implementation related to the construction of a green cross-dock terminal in the Swidnik Business Activity Zone in Lubelskie Voivodeship, Poland. Schoenherr advised the contractor. | EUR10million | Poland | |
3-Jul | Rymarz Zdort | Rymarz Zdort represented Polskie Goornictwo Naftowe i Gazownictwo S.A. in arbitration proceedings against PAO Gazprom and OOO Gazprom Export involving PGNiG's demand that the contract price for gas supplied by Gazprom under an agreement commonly known as the Yamal Contract be revised. | N/A | Poland | Here |
3-Jul | Greenberg Traurig | Greenberg Traurig advised Panattoni Development Europe on the acquisition of an undeveloped plot in Gdansk from unidentified sellers. | N/A | Poland | Here |
3-Jul | Dentons; DLA Piper | DLA Piper advised Grupa PZU on the lease of 47,000 square meters of office, retail, and warehouse space in the Generation Park Y in Warsaw from Skanska. Dentons advised Skanska on the deal. | PLN787million | Poland | Here |
3-Jul | Kochanski & Partners | Kochanski & Partners helped Forteam Investments overcome the attempt by Polish entrepreneur Mariusz Switalski to have the District Court in Poznan lift an injunction against him and his assets in an ongoing proceeding. | USD86million | Poland | Here |
7-Jul | Gessel | Gessel advised the Polish Stem Cell Bank on the signing of a preliminary contract for the purchase of 100% of shares in Germany's Eticur from InGeneron and another owner. | N/A | Poland | Here |
7-Jul | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Fitch Ratings on the multi-stage restructuring of the Fitch Group in Europe. | N/A | Poland | Here |
8-Jul | DLA Piper | DLA Piper advised Katoen Natie, an international logistics service provider and port operator, on the acquisition of the Polish warehousing activities of the Nijhof-Wassink logistics company. The sellers were advised by solo practitioner Boguslaw Kanski. | N/A | Poland | Here |
8-Jul | Mrowiec Fialek & Partners | Mrowiec Fialek & Partners advised Mota-Engil Real Estate Management on its issuance of private corporate bonds. | PLN15million | Poland | Here |
9-Jul | Greenberg Traurig | Greenberg Traurig advised Lee Hecht Harrison on the acquisition of the enterprise of Development & Business Consulting Gniazdowski i Partnerzy sp.k., which had been operating as the Polish Lee Hecht Harrison representative. | N/A | Poland | Here |
9-Jul | Baker Mckenzie; DLA Piper | DLA Piper advised private equity investor Resource Partners on the sale of a majority stake in Golpasz to De Heus, an international animal feed manufacturer. Baker McKenzie advised De Heus on the deal. | N/A | Poland | Here |
10-Jul | Norton Rose Fulbright; Rosicki, Grudzinski & Co. | Norton Rose Fulbright advised Bank Polska Kasa Opieki S.A. on refinancing the debt of Polska Zegluga Morska Group companies in connection with the acquisition of five vessels. Rosicki, Grudzinski & Co. advised Polska Zegluga. | N/A | Poland | Here |
13-Jul | Clifford Chance | Clifford Chance advised mBank S.A. on Echo Investment S.A.'s up-to-PLN 150 million bond issuance. | PLN150million | Poland | Here |
14-Jul | SMM Legal | SMM Legal advised the Energa Group on the acquisition of a wind farm project in Poland from Energa Invest. | N/A | Poland | Here |
15-Jul | Balicki Czekanski Gryglewski Lewczuk; Grant Thornton; WKB Wiercinski Kwiecinski Baehr | WKB advised Orbico and Distribev Orbico on the sale of 80% of shares in the share capital of Distribev Orbico to United Beverages. Grant Thornton advised United Beverages. BCGL advised Bank Pekao S.A. on its provision of financing for the acquisition. | N/A | Poland | Here |
15-Jul | Linklaters | Linklaters advised Chariot Top Group BV on the EUR 1 billion sale of a 1.8 hectare investment plot in Katowice, Poland, to unnamed buyers. | EUR1billion | Poland | Here |
15-Jul | Norton Rose Fulbright | Norton Rose Fulbright advised the Accolade Group on its acquisition and development of a new multi-tenant logistics park in Gorzow Wielkopolski, Poland. | EUR47million | Poland | Here |
15-Jul | Gessel | Gessel advised Creepy Jar and Ipopema Securities shareholders on the sale of Creepy Jar shares in a public offering via an accelerated book-building procedure. | PLN45million | Poland | Here |
22-Jul | Norton Rose Fulbright | Norton Rose Fulbright advised a consortium of ten banks on a PLN 5.5 billion loan to Gaz-System, Poland's designated natural gas transmission system operator. | PLN5.5billion | Poland | Here |
24-Jul | Kurzynski Kosinski Lyszyk Wierzbicki; Soltysinski Kawecki & Szlezak | Soltysinski Kawecki Szlezak advised IKEA Industry Poland, a member of the IKEA Group, on the sale of its furniture factory in Konstantynow Lodzki to a member of Latvia's Vakaru Medienos Grupe. Kurzynski Kosinski Lyszyk Wierzbicki advised Vakaru Medienos on the deal. | N/A | Poland | Here |
24-Jul | Rymarz Zdort | Rymarz Zdort advised PGNiG S.A. on the execution of a five-year agreement with Klaipedos Nafta for the use of the entire capacity of its liquid natural gas tanker truck reloading station in Klaipeda, Lithuania. | N/A | Poland | Here |
27-Jul | Allen & Overy; Clifford Chance | Clifford Chance advised a consortium consisting of the EBRD, ING Bank Slaski, mBank, and Santander Bank Polska on financing of PLN 480 million to Polenergia for the construction of a 121 MW wind farm in Debsk, Poland. Allen & Overy advised Polenergia. | PLN480million | Poland | Here |
27-Jul | CK Legal; Greenberg Traurig | Greenberg Traurig advised UBS and Ipopema Securities on Ryvu Therapeutics' PLN 140 million new share offering. Chabasiewicz, Kowalska, and Partners advised Ryvu Therapeutics. | PLN140million | Poland | Here |
28-Jul | CMS | CMS advised Bonair on its sale to the Netherlands' Fellowmind group, which is owned by Sweden's FSN Capital private equity fund. | N/A | Poland | Here |
28-Jul | GTS Legal; SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Kom-Eko on its acquisition of 69.46% of shares in Lubelska Agencja Ochrony Srodowiska. | N/A | Poland | Here |
28-Jul | Noerr; Rapala Law Firm | Noerr advised Telekom Innovation, a strategic investment fund of Deutsche Telekom, on an unspecified equity investment in Poland's RemoteMyApp technology company. The Rapala Law Firm advised RemoteMyApp. | N/A | Poland | Here |
28-Jul | Schoenherr | Schoenherr advised Panattoni Europe on its lease of space at Poland's Panattoni Park Ruda Slaska II to Dywidag-Systems International sp. z o.o., a producer of geotechnical and compression systems. | N/A | Poland | Here |
29-Jul | Allen & Overy; Brockhuis Jurczak Prusak Sroka Nilsson; Clifford Chance; Soltysinski Kawecki & Szlezak | BSJP successfully represented Polish cement producer Dyckerhoff Polska in cartel proceedings pending since 2006. Allen & Overy, Clifford Chance, Wardynski & Partners, and SK&S Soltysinski Kawecki & Szlezak advised various plaintiffs. | EUR100million | Poland | |
30-Jul | Kochanski & Partners | Kochanski & Partners successfully represented Ringier Axel Springer Polska in a dispute with the Polish Filmmakers Association that reached Poland's Supreme Court involving the calculation of royalties. | N/A | Poland | Here |
30-Jul | DLA Piper; Hogan Lovells | Hogan Lovells advised arrangers and investors ING Bank NV and ING Bank Slaski S.A. on the securitization of the portfolio of receivables from leasing contracts of Santander Consumer Multirent. The issuer was advised by DLA Piper. | PLN950million | Poland | |
31-Jul | Kochanski & Partners | Kochanski & Partners successfully represented Polish journalist Mikolaj Podolski in criminal proceedings. | N/A | Poland | Here |
31-Jul | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Polish resin manufacturer LERG S.A. on the acquisition of CIECH Zywice, another Polish resin manufacturer. | EUR36million | Poland | Here |
4-Aug | BCGL; Schoenherr | Schoenherr advised shareholders of Dagat-Eco on sale of 100% of shares in Dagat-Eco sp. z o.o. to Omikron PE. BCGL advised Dagat-Eco. | N/A | Poland | |
5-Aug | Baker Mckenzie; Clifford Chance | Baker McKenzie advised PKN Orlen on a revolving facility agreement under English law with a consortium of 16 banks. Clifford Chance advised the lenders on the deal. | EUR1.75billion | Poland | Here |
6-Aug | KPRF Law Office; Linklaters | Linklaters advised Chariot Group, a company managed by Griffin Real Estate, on the extension of leases with Auchan Poland for six retail properties. The KPRF Law Office advised Auchan Poland. | N/A | Poland | Here |
6-Aug | Matczuk, Wieczorek i Wspolnicy; Schoenherr | Schoenherr advised the Polish subsidiary of the Assa Abloy Group on the acquisition of 100% of the shares in Donimet BIS sp. z o.o. Matczuk, Wieczorek i Wspolnicy advised Donimted BIS. | N/A | Poland | |
7-Aug | Bird & Bird; Norton Rose Fulbright | Bird & Bird advised Wento and Enterprise Investors on the EUR 50 million sale of Eco Power sp. z o.o. to PGE Energia Odnawialna. The Warsaw office of Norton Rose Fulbright advised the buyers on the deal. | EUR50million | Poland | Here |
10-Aug | Baker Mckenzie | Baker McKenzie advised ElectroMobility Poland SA on agreements with Torino Design and EDAG Engineering Gmbh regarding the construction and assembly of electric cars in Poland. | N/A | Poland | Here |
11-Aug | Decisive Worldwide Szmigiel Papros Gregorczyk. | Decisive Worldwide Szmigiel Papros Gregorczyk advised the Skarbiec Dochodowych Nieruchomosci Fizan investment fund on the negotiation and sale of retail premises in Wroclaw's Old Town. | N/A | Poland | Here |
17-Aug | Dentons; DLA Piper; Greenberg Traurig | Greenberg Traurig advised Panattoni Development Europe on the sale of the Lodz City VI logistics park to Kajima Properties and Savills Investment Management. DLA Piper advised Savills Investment Management and Dentons advised Kajima Properties. | N/A | Poland | Here |
17-Aug | CMS; Freshfields; Wistrand; WKB Wiercinski Kwiecinski Baehr | CMS and Sweden's Wistrand law firm advised Nordex SE on its execution of a put option agreement for the potential sale of Nordex's European wind and photovoltaic development pipeline to RWE. Freshfields Bruckhaus Deringer and WKB reportedly advised RWE on the transaction. | EUR402.5million | Poland | Here |
21-Aug | Dentons; Greenberg Traurig | Greenberg Traurig advised the Metropol Group on the acquisition of regional shopping centers in the Polish cities of Gdynia, Olkusz, Radom, Swietochlowice, and Siemianowice from subsidiaries of the Atrium group. Dentons advised the Atrium Group on the deal. | N/A | Poland | Here |
25-Aug | Gessel | Gessel advised CD Projekt on the buy-back of its shares. | PLN214million | Poland | Here |
27-Aug | B2Rlaw; Dagital Legal; Dentons; Ssw Pragmatic Solutions | SSW Pragmatic Solutions advised BoomBit on its sale of a part of its shareholding in SuperScale to British venture capital fund Level-Up. Dentons advised Level-Up on the deal while B2RLaw, working with London's Fieldfisher and Bratislava's Dagital Legal law firms, also advised BoomBit and its founder Ivan Trancik. | N/A | Poland | Here |
28-Aug | Eversheds Sutherland; Latham & Watkins | Eversheds Sutherland advised Icos Capital on an unspecified Series B investment in Carbon Clean Solutions. Latham & Watkins advised Carbon Clean Solutions on the deal. | N/A | Poland | Here |
31-Aug | B2RLaw | B2RLaw assisted USPTC with a consultancy project relating to the merger of Politechnika Bialostocka and the University of Bialystok. | N/A | Poland | Here |
31-Aug | B2RLaw; Dechert | B2RLaw and Dechert advised Barings BDC, Inc. on its merger with MVC Capital, Inc. | N/A | Poland | Here |
31-Aug | Greenberg Traurig | Greenberg Traurig advised Ekstraklasa S.A. on the sale of media rights for the Polish premier football league to broadcast networks CANAL+ and TVP. | PLN1billion | Poland | Here |
2-Sep | Wolf Theiss | Wolf Theiss advised Concept Development BSD 2 on the sale of the 9000-square-meter 15-floor Concept Tower office building in Warsaw to the CPI Property Group. | N/A | Poland | Here |
3-Sep | Bird & Bird; Smolarek Rogala Caban | Bird & Bird advised mBank on a financing and refinancing deal with Nordic Solar Energy related to the construction of 26 solar farms in northwestern Poland. Smolarek Rogala Caban advised Nordic Solar Energy on the deal. | N/A | Poland | Here |
3-Sep | Decisive Worldwide Szmigiel Papros Gregorczyk | Decisive Szmigiel Papros Gregorczyk advised the Revetas Group on its lease of almost 2600 square meters of space in Warsaw's Trinity One office building to the local branch of an unidentified telecom holding company. | N/A | Poland | Here |
3-Sep | Gessel; Grabarek Szalc i Wspolnicy | Gessel advised OEX on an investment in iPOS that will see OEX take up newly issued shares constituting the majority of iPOS' share capital. Grabarek Szalc i Wspolnicy reportedly advised iPOS on the deal. | N/A | Poland | Here |
4-Sep | Baker Mckenzie; Greenberg Traurig | Greenberg Traurig advised Oanda Global Corporation on the acquisition of Dom Maklerski TMS Brokers S.A from Nabbe Investments, a subsidiary of PineBridge Investments. Baker McKenzie advised Nabbe and PineBridge Investments on the deal. | N/A | Poland | Here |
7-Sep | Dentons; Greenberg Traurig | Greenberg Traurig advised Invesco Real Estate on the sale of a logistics center in Lodz to Savills Investment Management, acting on behalf of Savills IM European Logistics Fund 2. Dentons advised the buyer on the deal. | N/A | Poland | Here |
7-Sep | Grochowicz Law Office | The Grochowicz Law Office advised Stena Investment S.a.r.l. on the sale of its Polish subsidiaries Shaletech Energy sp. z o.o. and Northam sp. z o.o. in a management buyout. | N/A | Poland | Here |
7-Sep | Mrowiec Fialek & Partners | Mrowiec Fialek and Partners advised Redan SA on the sale of shares in Top Secret sp. z o.o. to the company's majority shareholder. | N/A | Poland | Here |
9-Sep | Dentons | Dentons advised MaForm Holding Luxembourg S.A R.L. on its tender offer to purchase 66% of shares in WSE-listed Fabryki Mebli Forte S.A. | N/A | Poland | Here |
9-Sep | NautaDutilh; Wardynski & Partners | Wardynski & Partners, working alongside NautaDutilh, advised Desch Holding B.V. on its acquisition of 100% of shares in Interplast Plastic Products sp. z o.o. | N/A | Poland | |
9-Sep | BWHS Wojciechowski Springer i Wspolnicy | BWHS Wojciechowski Springer i Wspolnicy advised Uranpres, spol. s.r.o. on a EUR 70 million construction agreement with a consortium consisting of Mirbud S.A, Kobylarnia S.A, and Zrzeszenie Budowlane Interbudmontaz. | EUR70million | Poland | Here |
9-Sep | CMS | CMS advised Aareal Bank on the EUR 153 million refinancing of Accolade Group's industry parks portfolio, which includes locations in the Polish communities of Szczecin, Bydgoszcz, Lublin, Legnica, Bialystok, and Zielona Gora. | EUR153million | Poland | Here |
10-Sep | Decisive Worldwide Szmigiel Papros Gregorczyk | Decisive Szmigiel Papros Gregorczyk advised Nexity Polska on a general construction agreement with Wegner. | N/A | Poland | Here |
10-Sep | CMS; Wolf Theiss | Wolf Theiss advised the European Investment Bank on a EUR 10 million financing to Scope Fluidics S.A., a Polish medical technology company that designs diagnostic systems. CMS advised Scope Fluidics on the deal. | EUR10million | Poland | Here |
17-Sep | Clifford Chance; White & Case | White & Case advised Valmet on its acquisition of the PMP Group. Clifford Chance Warsaw advised the seller on the deal. | EUR64million | Poland | Here |
18-Sep | DLA Piper; Noerr | DLA Piper advised the founder of Top System, a flexible packaging company in the dairy industry in Poland, on the sale of an 80% stake to Switzerland's Aluflexpack. Noerr advised Aluflexpack on the deal. | N/A | Poland | Here |
20-Sep | Bartosz Kalupa; DLA Piper; Kondracki Celej; Wardynski & Partners; White & Case | DLA Piper and Batosz Kalupa assisted TDJ-Pitango Ventures Holding; Kondracki Celej assisted Manta Ray Ventures, RST Ventures for Earth, and Movens Venture Capital; and Wardynski & Partners assisted a private individual on their subscription to new shares in StethoMe sp. z o.o. White & Case advised the StethoMe. | N/A | Poland | |
20-Sep | Aabo-Evensen & Co; Schjodt; Wardynski & Partners | Wardynski & Partners, working alongside Aabo-Evensen & Co, advised Danish IT group KMD -- part of the NEC Corporation -- on Polish aspects of the acquisition by its Banqsoft subsidiary of Norwegian software company Concent. Schjodt advised Banqsoft. | N/A | Poland | |
21-Sep | Dentons; Greenberg Traurig | Greenberg Traurig advised Madison International Realty on its acquisition of an unspecified stake in Cavatina Office sp. z o.o., the owner of the Chmielna 89 office building in Warsaw, from Cavatina Holding S.A., as well as on its entry into a joint venture agreement with Cavatina Holding S.A. and the refinancing of the existing bank debt of Cavatina Office sp. z o.o. Dentons reportedly advised Cavatina Holding S.A. on the deal. | N/A | Poland | Here |
22-Sep | Jeantet; Jones Day; Nautadutih; Noerr; Wardynski & Partners | Noerr is advising the Schwarz Group on its intended takeover and potential entrance into a strategic partnership with the French Suez Group in the waste disposal and recycling business. Jones Day and Wardynski & Partners advised Suez on the deal. NautaDutilh in Luxembourg and the Netherlands and Jeantet in France worked on the deal as well. | EUR1.1billion | Poland | Here |
24-Sep | Dentons; DLA Piper | DLA Piper in Poland advised Elite Partners Capital on the acquisition of a warehouse in the Polish town of Mszczonow from P3 Logistic Parks. Dentons advised P3 Logistic Parks on the deal. | N/A | Poland | Here |
25-Sep | DLA Piper | DLA Piper helped Aerotunel obtain financing from Pekao bank for the construction of the Deepspot diving pool in the Polish town of Mszczonow, together with conference and hotel facilities. The BB law firm advised Pekao bank on the deal. | N/A | Poland | Here |
28-Sep | Clifford Chance; Gorzelnik Nentwig Ziebinski; Sorainen | Clifford Chance advised Sun Investment Group Polska on the sale of a 170 megawatt solar parks portfolio currently under development to Ignitis Renewables. Gorzelnik Nentwig Ziebinski and Sorainen advised the buyer on the deal. | N/A | Poland | Here |
28-Sep | Bredin Prat; Soltysinski Kawecki & Szlezak; White & Case | White & Case advised Play Communications and its shareholders, Novator and Olympia, on the EUR 2.2 billion sale of all of its shares to French telecommunication provider Iliad SA. Bredin Prat and Soltysinski, Kawecki & Szlezak advised the buyer on the deal. | EUR2.2billion | Poland | Here |
30-Sep | Greenberg Traurig | Greenberg Traurig helped OTB Ventures launch a dedicated investment vehicle to support Europe's space technologies - the OTB Space Program I - backed by the European Investment Fund and the European Commission through the InnovFin for Equity program. | N/A | Poland | Here |
1-Oct | SMM Legal | SMM Legal advised PKN Orlen S.A. on its tender offer to buy the remaining shares in Energa S.A. | N/A | Poland | Here |
1-Oct | Brockhuis Jurczak Prusak Sroka Nilsson; Schoenherr | BSJP advised DB Schenker on the real estate acquisition and investment implementation related to the construction of a green cross-dock terminal located at the Rzeszow-Dworzysko Science and Technology Park in Podkarpackie Voivodeship, Poland. Schoenherr advised the contractor. | EUR11million | Poland | |
2-Oct | Dentons; Gorzelnik Nentwig Ziebinski | GNZ Legal advised WPM Mosty on a successful financing and refinancing deal with mBank for the construction of a 10 megawatt portfolio of photovoltaic projects. Dentons advised mBank. | N/A | Poland | Here |
5-Oct | Bird & Bird | Bird & Bird helped Santander Bank Polska implement the Salesforce CRM cloud-based system in Poland. | N/A | Poland | Here |
5-Oct | Ozog Tomczykowski; Soltysinski Kawecki & Szlezak | Soltysinski Kawecki & Szlezak advised Britain's Smart Pension Ltd on the takeover of an IT team from Smart Pension's contractor, Code & Pepper. The Ozog Tomczykowski law firm advised Code & Pepper. | N/A | Poland | Here |
6-Oct | Grant Thornton; Studnicki, Pleszka, Cwiakalski, Gorski | SPCG advised the Vafo Group on its acquisition of 100% of the shares in Carry Pet Food. Grant Thornton advised the seller on the deal. | N/A | Poland | Here |
6-Oct | Benvalor; Eversheds Sutherland; Malecki Legal; Soltysinski Kawecki & Szlezak | Eversheds Sutherland advised Cogito Capital Partners on its EUR 3.7 million Series A investment in digital healthcare provider HomeDoctor. Malecki Legal, Soltysinski Kawecki & Szlezak, and the Netherlands' Benvalor law firm advised HomeDoctor and its founders on the deal. | EUR3.7million | Poland | Here |
7-Oct | JDP | JDP advised Free Now, the owner and operator of a ride sharing app, on compliance matters related to the new set of regulations in Poland applicable to the ride share market. | N/A | Poland | Here |
8-Oct | JDP | JDP advised Trei Real Estate GmbH on a EUR 51 million loan it received for its Polish subsidiaries from pbb Deutsche Pfandbriefbank. | EUR51million | Poland | Here |
9-Oct | JDP | JDP assisted the Greenpack Group with the establishment of a legal and tax presence in Poland. | N/A | Poland | Here |
9-Oct | Gessel | Gessel advised the founders of R2G Polska on the sale of a block of shares to a subsidiary of the Abris CEE Mid-Market III LP fund, managed by Abris Capital Partners Ltd. | N/A | Poland | Here |
9-Oct | SMM Legal | SMM Legal advised Miedzynarodowe Targi Poznanski on its sale of a 5.5 hectare plot in the center of Poznan, Poland. | PLN114.5million | Poland | Here |
12-Oct | WKB Wiercinski Kwiecinski Baehr | Wiercinski, Kwiecinski, Baehr worked alongside lead counsel Osborne Clark in advising Giant Ventures on the Polish aspects of an unspecified investment in Airly sp. z o.o. | N/A | Poland | Here |
12-Oct | WKB Wiercinski Kwiecinski Baehr | Wiercinski, Kwiecinski, Baehr advised Baltic Green I sp. z o.o. on contractor selection for the Katy Wind Farm project in Poland. | N/A | Poland | Here |
12-Oct | Kochanski & Partners | Kochanski & Partners is representing Polish tennis player Katarzyna Kawa pro bono in her dispute against the International Tennis Federation and the French Tennis Federation. | N/A | Poland | Here |
12-Oct | Act BSWW | Act BSWW advised Pracuj Ventures on the acquisition of a minority stake in Gamfi. | N/A | Poland | Here |
12-Oct | Allen & Overy; Clifford Chance | Clifford Chance advised mBank on a PLN 150 million loan to Polenergia for the VAT and costs of construction of the Kostomloty wind farm in Poland. Allen & Overy advised Polenergia on the deal. | PLN150million | Poland | Here |
13-Oct | Allen & Overy; Clifford Chance; Greenberg Traurig | Greenberg Traurig and Allen & Overy advised the global coordinators, joint bookrunners, and lead managers on Allegro.eu's IPO and the admission of Allegro shares to listing on the Warsaw Stock Exchange. Clifford Chance advised Allegro on the IPO. | PLN9.2billion | Poland | Here |
15-Oct | Studnicki, Pleszka, Cwiakalski, Gorski | SPCG represented a group of former shareholders of Merlin.pl S.A. in a dispute with Switalski & Synowie Sp. z o.o. | N/A | Poland | Here |
15-Oct | DWF; Norton Rose Fulbright | DWF advised Enertrag on the sale of the Dargikowo and Karlino windparks in Poland to Allianz Capital Partners. Norton Rose Fulbright advised Allianz Capital Partners on the deal. | N/A | Poland | Here |
16-Oct | Crido Legal; DWF | Crido Legal advised the Avenger Flight Group on its entry onto the Polish market and establishment of a joint venture with Enter Air. DWF Poland advised Enter Air. | N/A | Poland | Here |
16-Oct | Wardynski and Partners; Willkie Farr & Gallagher | Wardynski and Partners, working alongside Willkie Farr & Gallagher, advised CapVest Partners on its acquisition of Greenland Seafood from Pacific Andes through a portfolio company called Eight Fifty Food Group Limited. | N/A | Poland | |
16-Oct | Clifford Chance; Dentons | Dentons Poland advised DNB Bank Polska on its PLN 155 million financing package for Wilko 5, a special purpose vehicle of the Helios Energy Investments Fund, for the construction of five wind farms in Poland's Wielkopolskie region. Clifford Chance advised the borrowers on the deal. | PLN155million | Poland | Here |
16-Oct | Eversheds Sutherland; White & Case | Eversheds Sutherland Wierzbowski advised the EEC Magenta fund on its PLN 12 million investment in CashDirector, a financial platform supporting small and medium-sized enterprises in liquidity management. White & Case advised CashDirector on the deal. | PLN12million | Poland | Here |
19-Oct | Freshfields; Wardynski & Partners | Wardynski & Partners, working alongside Freshfields Bruckhaus Deringer, advised British digital sports media company DAZN Group on the divestment of a majority stake in its football news website Goal.com to Integrated Media Company, a platform backed by US-based investment firm TPG. | N/A | Poland | |
19-Oct | DWF; Haynsworth Sinkler Boyd; Mayer Brown; Wolf Theiss | DWF, working with US lead counsel Haynsworth Sinkler Boyd, advised Sonoco Products Company on the USD 120 million sale of its Europe contract packaging business, Sonoco Poland-Packaging Services sp. z o.o., to Prairie Industries Holdings. Mayer Brown and Wolf Theiss advised Prairie Industries Holdings on the transaction. | USD120milion | Poland | Here |
21-Oct | Greenberg Traurig | Greenberg Traurig advised Innova/5 on its sale of an unspecified stake in Pekaes to Geodis in Poland. | N/A | Poland | Here |
22-Oct | Eversheds Sutherland | Eversheds Sutherland Wierzbowski advised Ricoh on the acquisition of IT company SimplicITy. | N/A | Poland | Here |
22-Oct | Gessel | Gessel advised Benefit Systems on its issuance of Series A and B bonds valued at PLN 100 million and their admission to trading on the Warsaw Stock Exchange's Alternative Trading System platform, as well as the bookrunner on the issuance, the Polish branch of Haitong Bankas. | PLN100million | Poland | Here |
22-Oct | Gessel | Gessel advised Poland-based paraffin producer Polwax on the public offering of its shares with subscription rights and admission of shares to trading on the Warsaw Stock Exchange. | PLN20Million | Poland | Here |
23-Oct | Greenberg Traurig; SSW Pragmatic Solutions | Greenberg Traurig advised the Innova/6 private equity fund on its acquisition of a majority stake in Poland-based software developer STX Next from Maciej Dziergwa and other unnameds shareholders. SSW Pragmatic Solutions advised the sellers on the deal. | N/A | Poland | Here |
23-Oct | Rymarz Zdort; White & Case | Rymarz Zdort advised MCI.PrivateVentures and AMC Capital IV Albatros S.a r.l. on their sale of ATM S.A. to Global Compute Infrastructure LP, a platform supported by the Goldman Sachs Merchant Banking Division. White & Case advised Global Compute Infrastructure on the transaction. | N/A | Poland | Here |
23-Oct | Greenberg Traurig; Plesner Advocatfirmet; Wardynski and Partners | Wardynski and Partners, working alongside Plesner Advocatfirmet, advised Danish company Faerch A/S on its acquisition from Sirap Gema S.p.A. of its Polish subsidiary Inline Poland sp. z o.o. Greenberg Traurig advised the seller. | N/A | Poland | |
23-Oct | DAHL; Gorrissen Federspiel; Wardynski and Partners | Wardynski and Partners and Gorrissen Federspiel advised Danish company SDK A/S on its acquisition of the Polish subsidiaries -- Freja Transport & Logistics p. z o.o. and Transcargo sp. z o.o -- of Danish company Freja A/S. DAHL advised the seller. | N/A | Poland | |
26-Oct | Latham & Watkins; Linklaters; Wardynski and Partners | Wardynski and Partners and Latham & Watkins advised Canpack S.A. as a co-issuer with Eastern PA Land Investment Holding LLC on its successful issue of EUR 600 million aggregate principal amount senior notes at 2.375% due 2027 and USD 400 million aggregate principal amount senior notes at 3.125% due 2025 under the laws of the state of New York. Linklaters advised the bond purchasers. | EUR600millionandUSD400million | Poland | |
27-Oct | B2Rlaw | B2RLaw advised the Life Science Innovation Fund on an unspecified investment in telemedicine startup Aidlab. | N/A | Poland | Here |
27-Oct | Decisive Worldwide Szmigiel Papros Gregorczyk | Decisive Worldwide Szmigiel Papros Gregorczyk advised France's Nexity Group on an agreement to work on an unspecified development project with Erbud. | N/A | Poland | Here |
27-Oct | Gessel | Gessel advised the Polish high-tech company DataWalk on the public offering of its new issue of shares worth approximately PLN 65 million to qualified investors via a book-building process. | PLN65million | Poland | Here |
28-Oct | Rymarz Zdort | Rymarz Zdort advised shareholders Mariusz Cieply and Maciej Jarzebowski on the sale of their shares in LiveChat Software S.A. in an accelerated bookbuilding process. | N/A | Poland | Here |
29-Oct | Clifford Chance; CMS | Clifford Chance's Warsaw office advised a consortium of banks including Santander Bank Polska S.A., Bank Millennium S.A., and Bank Polska Kasa Opieki S.A. on financing for Gemini Polska. CMS advised Gemini Polska on the deal. | N/A | Poland | Here |
29-Oct | B2Rlaw; Jakub Kapica | B2RLaw advised KnowledgeHub on its EUR 1 million investment in Genomtec. Solo practitioner Jakub Kapica advised Genomtec on the deal. | EUR1million | Poland | Here |
30-Oct | Wiercinski Kwiecinski Baehr | Wiercinski, Kwiecinski, Baehr advised E&W, which belongs to Danish Eurowind Energy A/S and Windbud Sp. z o.o., on agreements to construct four wind farms in Poland. | N/A | Poland | Here |
30-Oct | DLA Piper; Rymarz Zdort | Rymarz Zdort advised Nemera on the acquisition of Copernicus sp. z o.o. DLA Piper advised the unidentified sellers on the transaction. | N/A | Poland | Here |
30-Oct | B2Rlaw | B2RLaw advised Apis Venture on an unspecified investment in the Polish video game developer Byte Barrel. | N/A | Poland | Here |
30-Oct | Brzozowska & Barwinska; DLA Piper | DLA Piper advised Polish banks PKO BP and Santander on a PLN 113.5 million loan to Rockfin, an engineering company from the THC SICAV-RAIF portfolio. Brzozowska & Barwinska advised Rockfin and Tar Heel Capital Sp.z.o.o., the advisory company to the THC SICAV-RAIF fund, on the deal. | PLN113.5million | Poland | Here |
2-Nov | Bredin Prat; Clifford Chance; Herbert Smith Freehills; Soltysinski Kawecki & Szlezak | Clifford Chance and Herbert Smith Freehills advised Cellnex Telecom on its agreement with French telecommunication company Iliad SA to acquire a 60% stake in a new company that will operate Iliad-owned Play Communications' approximately 7,000 telecommunications sites in Poland. Soltysinski Kawecki & Szlezak and Bredin Prat advised Iliad. | EUR800million | Poland | Here |
3-Nov | Clifford Chance; Norton Rose Fulbright | Clifford Chance advised the Three Seas Initiative Investment Fund on its acquisition of Industrial Division from Abris Capital Partners. Norton Rose Fulbright advised the seller on the deal. | N/A | Poland | Here |
3-Nov | Decisive Worldwide Szmigiel Papros Gregorczyk | Decisive Szmigiel Papros Gregorczyk successfully represented Enel Invest, a member of the Enel-Med Group, in a lawsuit filed against its landlord. | PLNÊ120000 | Poland | Here |
4-Nov | Dentons; Greenberg Traurig | Greenberg Traurig advised CA Immobilien Anlagen AG on the acquisition of P14 Sp. z o.o., the owner of the Postepu 14 office building in Warsaw, from HB Reavis. Dentons advised the sellers on the deal. | N/A | Poland | Here |
4-Nov | Kirkland & Ellis; Schoenherr | Schoenherr and Kirkland & Ellis advised Summit Partners on its acquisition of a stake in product-information provider Syndigo. | N/A | Poland | |
6-Nov | DLA Piper; Linklaters | DLA Piper advised the PORR construction company on the sale of all its shares in Stal-Service to the Celsa Huta Ostrowiec steel plant in Poland. Linklaters advised Celsa Huta Ostrowiec. | N/A | Poland | Here |
6-Nov | Domanski Zakrzewski Palinka | Domanski Zakrzewski Palinka and BIM Klaster, working with the European Commission, helped PwC develop a roadmap for the implementation of BIM methodology in public procurement together with templates of BIM documents for the Polish Ministry of Development. | N/A | Poland | Here |
6-Nov | SSW Pragmatic Solutions; Vinge; Wardynski & Partners | Wardynski & Partners and Vinge advised Granges AB on its acquisition of Aluminium Konin from the Boryszew Group. SSW Pragmatic Solutions advised the seller. | EUR210million | Poland | |
6-Nov | Brockhuis Jurczak Prusak Sroka Nilsson | BSJP successfully represented DHV Polska, a subsidiary of the Netherlands-based DHV Royal Haskoning, which offers aviation, building, and architectural services, in a dispute with Poland's General Directorate for National Roads and Motorways (GDDKiA) that has been pending since 2011. | EUR662000 | Poland | |
9-Nov | Kwasnicki, Wrobel & Partners | RKKW advised Omikron Capital on its acquisition of ZAP-Mechanika from an unidentified seller. | N/A | Poland | Here |
10-Nov | Krassowski Law Firm; Wiercinski Kwiecinski Baehr | The Krassowski Law Firm advised the Bielenda Kosmetyki Naturalne cosmetics company on its acquisition of the Dermika and Soraya brands and a production facility in Radzymin, Poland, from the Orkla Group. Wiercinski Kwiecinski Baehr advised the Orkla Group on the transaction. | N/A | Poland | Here |
10-Nov | Krassowski Law Firm; Linklaters | Linklaters advised the Lux Med Group on its acquisition of an unspecified stake in Lecznice Citomed. Krassowski advised the founders of Lecznice Citomed on the transaction. | N/A | Poland | Here |
11-Nov | Greenberg Traurig | Greenberg Traurig advised Panattoni Development Europe on its acquisition of an undeveloped plot of land near Nadarzyn, Poland. | N/A | Poland | Here |
11-Nov | Baker Mckenzie | Baker McKenzie advised Troax on its acquisition of Natom Logistic, a Polish manufacturer of warehouse equipment. KPMG Law advised the seller, Natom Logistic founder Tomasz Swiatek, on the transaction. | N/A | Poland | Here |
11-Nov | Decisive Worldwide Szmigiel Papros Gregorczyk | Decisive Szmigiel Papros Gregorczyk advised Nexity Polska on its acquisition of a plot of land in Warsaw's Bemowo district from an unspecified seller. | N/A | Poland | Here |
11-Nov | Baker Mckenzie; Dla Piper | DLA Piper advised Mid Europa Partners on the acquisition of a majority stake in GWD Concept Displate from its founders, Credo Ventures, and Miton Capital. Baker McKenzie advised the sellers on the transaction. | N/A | Poland | Here |
13-Nov | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Boryszew S.A. on the sale of Impexmetal S.A. to Sweden's Granges AB. The transaction was executed at Impexmetal's valuation of PLN 938 million. | PLN938million | Poland | Here |
16-Nov | Decisive Worldwide Szmigiel Papros Gregorczyk | Decisive Szmigiel Papros Gregorczyk helped Enel-Med extend its medical clinic lease agreement with the CPI Property Group until 2030. | N/A | Poland | Here |
16-Nov | Domanski Zakrzewski Palinka; SDZLegal Schindhelm | SDZLegal Schindhelm helped Max Streicher win a PLN 1 billion contract from Gaz-System to construct compressor stations in the Polish communities of Goleniow and Gustorzyn as a part of the Baltic Pipe project. Domanski Zakrzewski Palinka advised Gaz-System on the deal. | PLN1billion | Poland | Here |
18-Nov | Dentons | Dentons advised Stadler Polska on the conclusion of a framework agreement and execution of contracts worth PLN 600 million with Krakow's public transport company to provide 60 Lajkonik II trams. | PLN600million | Poland | Here |
19-Nov | B2RLaw | B2RLaw helped WalkSee attract an investment from the EVIG Alfa venture capital fund. | N/A | Poland | Here |
19-Nov | DPPA Legal; DWF | DWF advised International Workplace Group plc on its lease of space in the Skanska Wave complex in Gdansk. DPPA Legal advised Skanska on the deal. | N/A | Poland | Here |
20-Nov | Dentons; Greenberg Traurig | Greenberg Traurig advised Hines Pan-European Core Fund on the acquisition of a mezzanine warehouse facility in Wroclaw from GLL Real Estate Partners. Dentons advised GLL Real Estate Partners on the deal. | N/A | Poland | Here |
20-Nov | Dabrowski i Partnerzy; Wardynski and Partners | Wardynski and Partners advised Zhermack SpA (part of the DentsplySirona group) on the sale of 100% shares in the share capital of Zhermapol sp. z o.o. in a management buyout. The buyers were advised by Dabrowski i Partnerzy. | N/A | Poland | |
20-Nov | Freshfields; Noerr; Wardynski & Partners | Noerr's Warsaw office advised private equity firm Enterprise Investors and its portfolio company Nu-Med on the EUR 32.5 million refinancing of the indebtedness of the Nu-Med Grupa S.A. and six of its subsidiaries. The financing was provided by Kartesia, a private debt fund manager based in Luxembourg. Freshfields and Wardynski & Partners advised Kartesia. | EUR32.5million | Poland | |
23-Nov | Dentons; Rymarz Zdort | Dentons advised Aviva Investors on the sale of two warehouses in the Wroclaw Business Park to an unspecified construction company managed by Griffin Real Estate. Rymarz Zdort advised the buyer on the deal. | N/A | Poland | Here |
23-Nov | Kochanski & Partners | Kochanski & Partners helped Idea Bank become the first Polish financial service sector entity to obtain ISO 27017 and ISO 27001 certifications, confirming that its cloud computing solutions meet the necessary international standards. | N/A | Poland | Here |
23-Nov | Baker Mckenzie; Gessel | Gessel advised the Haitong Bank as the issue organizer, dealer, calculation agent, and documentation agent on Polska Grupa Farmaceutyczna's PLN 150 million bond issue. Baker McKenzie advised the issuer on the deal. | PLN150million | Poland | Here |
24-Nov | Baker Mckenzie; Sheridans | Baker McKenzie advised the Embracer Group on the acquisition of Polish game developer Flying Wild Hog from Supernova Capital. Sheridans advised the sellers on the deal. | N/A | Poland | Here |
26-Nov | SSW Pragmatic Solutions | SSW Pragmatic Solutions helped Mo-BRUK get prospectus approval from the Polish Financial Supervision Authority. | N/A | Poland | Here |
26-Nov | CMS; SSW Pragmatic Solutions | CMS advised British insurance intermediary PIB Group Limited on the acquisition of WDB, an independent insurance broker in Poland. SSW Pragmatic Solutions advised sellers Mariusz Muszynski, Mateusz Holly, and Piotr Kumiega on the deal. | N/A | Poland | Here |
26-Nov | Grant Thornton; Jara Drapala & Partners | Jara Drapala & Partners helped the 4PL Central Station Group establish a joint venture with an unidentified Polish company. Grant Thornton advised the Polish co-venturer on the deal. | N/A | Poland | Here |
27-Nov | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Stelmet on the squeeze-out and withdrawal of its shares from the Warsaw Stock Exchange. Stelmet's majority shareholder, Stanislaw Bienkowski, purchased all of the shares previously owned by minority shareholders. | N/A | Poland | Here |
30-Nov | DLA Piper; Greenberg Traurig | Greenberg Traurig advised Abris CEE Mid-Market Fund III L.P., managed by Abris Capital Ltd., on the acquisition of the Scanmed S.A. healthcare provider from Life Healthcare Group Holdings Limited. DLA Piper advised Life Healthcare Group Holdings on the transaction. | N/A | Poland | Here |
30-Nov | Rymarz Zdort | Rymarz Zdort advised European Logistics Investment on the acquisition of land and the construction of a high-tech warehouse complex in Radom, Poland. | N/A | Poland | Here |
1-Dec | Noerr | Noerr advised Verlagsgruppe Passau on the sale of its Polish publishing activities to PKN Orlen. | N/A | Poland | |
1-Dec | Brockhuis Jurczak Prusak Sroka Nilsson; Radzikowski, Szubielska I Wspolnicy | BSJP advised Silownie Wiatrowe Development, a Polish wind power developer, on a sale of RES-related assets located in Poland to Tauron Ekoenergia, a unit of Polish state-owned energy group Tauron Polska Energia. Radzikowski, Szubielska I Wspolnicy advised the buyer. | N/A | Poland | |
2-Dec | Act (BSWW); Hogan Lovells | Act BSWW advised investment funds managed by Pekao TFI S.A on the PLN 2.5 billion bonds issue program of Miejskie Przedsirbiorstwo Oczyszczania w m. st. Warszawie sp. z o.o., aimed at financing the modernization and extension of a municipal waste incineration plant and the construction of a waste segregation plant in Warsaw. The program was developed in cooperation with Bank Pekao S.A. and Pekao Investment Banking S.A., both of which were advised by Hogan Lovells. | PLN2.5billion | Poland | Here |
3-Dec | B2RLaw; Paul Hastings; Ropes & Gray; Soltysinski Kawecki & Szlezak | B2RLaw, working alongside lead counsel Ropes & Gray, advised a consortium of banks, including Goldman Sachs International and Barclays, as global coordinators and joint bookrunners, and HSBC and NatWest Markets as joint bookrunners, on Boparan Holding Ltd.'s GBP 475 million high yield bond issue of five-year (non-call two) 7.75% secured notes. The new financing package also includes a new GBP 80 million revolving credit facility. SK&S and Paul Hastings advised Boparan. | N/A | Poland | Here |
3-Dec | Allen & Overy; White & Case | White & Case advised joint bookrunner Erste Group Bank AG on the Tauron Polska Energia SA issue of Series A Bonds for a total nominal value of PLN 1 billion. Allen & Overy advised Tauron Polska Energia on the deal. | PLN1billion | Poland | Here |
3-Dec | Taylor Wessing | Taylor Wessing advised the MLP Group on the public offering of its EUR 15 million bonds and their placement on the alternative Catalyst market of the Warsaw Stock Exchange. | EUR15million | Poland | Here |
3-Dec | Chabasiewicz Kowalska & Partners; White & Case | Chabasiewicz Kowalska & Partners advised PragmaGO on the sale of 100% of its shares to Polish Enterprise Fund VIII, managed by Enterprise Investors. White & Case advised the buyer on the deal. | EUR11.9million | Poland | Here |
4-Dec | Rymarz Zdort | Rymarz Zdort advised European Logistics Investment on the acquisition of the Wroclaw Business Park warehouse complex from Aviva Investors. | N/A | Poland | Here |
4-Dec | Deloitte Legal | Deloitte Legal advised New Energy Investments on a green bonds issuance with a total nominal value of up to PLN 500 million. | PLN500million | Poland | Here |
7-Dec | B2RLaw | B2RLaw advised Skanska Residential Development on the acquisition of two properties in the Wlochy district of Warsaw from an unspecified seller. | PLN80million | Poland | Here |
8-Dec | CMS; SDZLegal Schindhelm | CMS advised Macquarie's Green Investment Group on the acquisition of an operational 25.3 MW onshore wind farm in the western Polish village of Jozwin from Vortex Energy Poland and Max Bogl International SE. SDZLegal Schindhelm advised the selling shareholders Max Boegl and VPL Projects. | N/A | Poland | Here |
9-Dec | Domanski Zakrzewski Palinka; Jacek Kosinski | Domanski, Zakrzewski, Palinka advised the Krakow Roads Authority on selecting a consortium of PPP Solutions Polska sp. z o.o. and Gulermak Agir Sanayi Insaat ve Taahhut a.s. as private contractor for the Krakow Fast Tram stage IV project, which involves the design, construction, and operation of the final stage of a new tram line. Jacek Kosinski advised the private partners on the deal. | PLN1.25billion | Poland | Here |
9-Dec | CMS | CMS advised the BaltCap Infrastructure Fund on its entrance into a public-private partnership agreement for the construction of street lighting in the municipality of Kobylnica, in Poland. | PLN12million | Poland | Here |
10-Dec | Studnicki, Pleszka, Cwiakalski, Gorski | Studnicki, Pleszka, Cwiakalski, Gorski advised Enterprise Investors on the reorganization of Nu-Med Grupa S.A. | N/A | Poland | Here |
11-Dec | Mrowiec Fialek & Partners; Rymarz Zdort | Mrowiec Fialek and Partners advised Ferro S.A. on the acquisition of a majority stake in Termet S.A. and 100% of the shares of Tester sp. z o.o. Rymarz Zdort advised the seller. | N/A | Poland | Here |
11-Dec | DLA Piper; Konieczny Wierzbicki | DLA Piper advised Polish Enterprise Fund VIII, managed by Enterprise Investors, on the acquisition of a majority stake in Polish software company Software Mind from Ailleron. Konieczny Wierzbicki advised Ailleron on the transaction. | PLN111million | Poland | Here |
15-Dec | Dentons; DWF | Dentons advised Heimstaden Bostad on its EUR 65 million acquisition of two build-to-rent projects in Warsaw's Praga-Polnoc and Sluzewiec districts from Eiffage Immobilier Polska. DWF advised the seller on the deal. | EUR65million | Poland | Here |
15-Dec | ARQIS; Brockhuis Jurczak Prusak Sroka Nilsson; SSW Pragmatic Solutions | BSJP and ARQIS advised Nethansa, a Polish startup offering Clipperon, an AI-driven sales and logistics automation software for the Amazon platform, on obtaining a late seed round funding in the amount of more than PLN 8 million from Movens VC, CofounderZone, and LT Capital investment funds. SSW Pragmatic Solutions advised investors Movens VC and CofounderZone. | EUR1.76million | Poland | |
16-Dec | Kancelaria Adwokacka Piotrowska Klak; Mrowiec Fialek & Partners | Mrowiec Fialek and Partners advised Schindler Polska on the acquisition of 100% of the share capital of Wroclawskie Przedsiebiorstwo Remontowe Urzadzen Dzwigowych sp. z o.o. Kancelaria Adwokacka Piotrowska Klak advised the seller. | N/A | Poland | |
17-Dec | Allen & Overy; White & Case | White & Case advised Mid Europa Partners on the acquisition of Sage Sp. z o.o. from The Sage Group plc, which was advised by Allen & Overy. | N/A | Poland | Here |
18-Dec | Linklaters; Wolf Theiss | Linklaters advised Echo Investment on the acquisition of investment properties developed by Tesco in Poznan, Lodz, and Krakow, for the purposes of developing residential, office, commercial, and service facilities. Wolf Theiss advised Tesco on the transaction. | EUR42million | Poland | Here |
21-Dec | Gessel | Gessel successfully represented the Black Forest Fund in proceedings before Poland's Office of Competition and Consumer Protection involving its takeover of Corab. | N/A | Poland | Here |
21-Dec | Gessel | Gessel successfully represented the former president of Plus Bank in a criminal trial. | N/A | Poland | Here |
22-Dec | Lesnodorski Slusarek i Wspolnicy | Lesnodorski, Slusarek i Wspolnicy, working pro bono, successfully represented journalist Polish Justyna Sliwowska-Mroz in her claims that an advertisement by Poland's Law and Justice party had violated her rights. | N/A | Poland | Here |
22-Dec | SSW Pragmatic Solutions | SSW Pragmatic Solutions advised Mercator Medical on the accelerated book-building of its shares and their subsequent PLN 200 million sale by shareholders Anabaza and Urszula Zyznowska. | PLN200million | Poland | Here |
23-Dec | Gessel | Gessel advised the owner of MotionVFX on an unspecified investment in the Nextline search fund. Solo practitioner Jacek Klimczak advised Nextline on the deal. | N/A | Poland | Here |
23-Dec | WKB Wiercinski Kwiecinski Baehr | Wiercinski, Kwiecinski, Baehr helped PineBridge Investments obtain clearance from the Polish competition authority for its acquisition of control over Benson Elliot Capital Management. | N/A | Poland | Here |
23-Dec | Taylor Wessing | Taylor Wessing Warsaw advised MLP Group S.A., in connection with the public offering of series D ordinary bearer stocks and the introduction of rights to series D stocks to trade on the main market of the Warsaw Stock Exchange. | N/A | Poland | Here |
23-Dec | Moskwa Jarmul Haladyj i Wspolnicy; Rymarz Zdort; SSW Pragmatic Solutions | Rymarz Zdort advised Bank Pekao S.A. on the acquisition of a 38.33% stake in Krajowy Integrator Platnosci S.A. Moskwa, Jarmul, Haladyj i Wspolnici advised KIP on the deal, while SSW Pragmatic Solutions advised the majority shareholder of Krajowy Integrator Platnosci. | N/A | Poland | Here |
23-Dec | Greenberg Traurig | Greenberg Traurig advised PCF Group S.A. on its IPO and admission of the shares to trading on the Warsaw Stock Exchange. | PLN203million | Poland | Here |
28-Dec | WKB Wiercinski Kwiecinski Baehr | Wiercinski, Kwiecinski, Baehr advised Nowe Jaworzno Grupa Tauron on the construction of a power unit with a nominal capacity of 910 MW in Jaworzno, Poland, following a mediation proceeding. | N/A | Poland | Here |
28-Dec | Greenberg Traurig | Greenberg Traurig advised HB Reavis Poland on a lease agreement with Leroy Merlin for office space at the Forest office campus in Warsaw. | N/A | Poland | Here |
28-Dec | CMS; Sadkowski i Wspolnicy | CMS advised Bank Pekao S.A on the sale of Dom Inwestycyjny Xelion to Quercus TFI S.A. Sadkowski i Wspolnicy advised Quercus on the transaction. | PLN38.5million | Poland | Here |
28-Dec | Domanski Zakrzewski Palinka | Domanski Zakrzewski Palinka advised the winning consortium of Aldesa Construcciones Polska sp. z o.o. and Aldesa Construcciones S.A. on a tender conducted by Poland's General Directorate for National Roads and Motorways for the design and building of the south Bialystok bypass on the Ksiezyno-Bialystok Poludnie section of Poland's S19 Expressway, together with the modernization of the DK 65 section. | PLN456.14million | Poland | Here |
28-Dec | Brockhuis Jurczak Prusak Sroka Nilsson | BSJP successfully represented DHV Polska in a dispute with Poland's General Directorate for National Roads and Motorways. | PLN2million | Poland | Here |
28-Dec | Domanski Zakrzewski Palinka | Domanski Zakrzewski Palinka helped Polskie Linie Lotnicze LOT S.A. obtain a positive European Commission decision approving state aid of PLN 2.9 billion. The EC found the aid aimed at mitigating the adverse effects of the COVID-19 pandemic compliant with EU rules. | EUR2.9billion | Poland | Here |
28-Dec | Gunderson Dettmer; Orrick | Orrick helped Brainly raise USD 80 million in Series D funding from a group of investors including Learn Capital, Prosus Ventures, Runa Capital, MantaRay, and General Catalyst. Gunderson Dettmer and B2RLaw advised Learn Capital on the deal. | USD80million | Poland | Here |
29-Dec | Gessel; Rymarz Zdort | Gessel advised the Black Forest Fund on an unspecified investment in ExploRNA. Rymarz Zdort advised ExploRNA on the deal. | N/A | Poland | Here |
29-Dec | Linklaters | Linklaters advised Austrian real estate asset and investment manager GalCap Europe on the acquisition of an office building in Warsaw from German investment fund UBS Real Estate GmbH. | N/A | Poland | Here |
29-Dec | Noerr; SSW Pragmatic Solutions | Noerr assisted Brammer S.A., part of Rubix Group, with its acquisition of 100% ofÊ PEPE Sp. z o.o., which is active in the distribution of acid proof stainless steel components. SSW Legal advised the target. | N/A | Poland | |
30-Dec | Dentons; Konieczny Wierzbicki | Dentons advised Nexity Polska on the sale of the La Praga residential project in Warsaw to Dutch fund Van der Vorm Vastgoed. Konieczny Wierzbicki advised the buyer on the deal. | N/A | Poland | Here |
30-Dec | Linklaters | Linklaters advised Resi4Rent on the acquisition of apartment buildings in Warsaw, Lodz, and Wroclaw from Echo Investment. | N/A | Poland | Here |
30-Dec | Studnicki, Pleszka, Cwiakalski, Gorski | Studnicki, Pleszka, Cwiakalski, Gorski successfully represented Tesco Polska in a dispute regarding the existence of a legal title to a property in a Warsaw shopping and service center. | N/A | Poland | Here |
30-Dec | Gessel; Noerr | Noerr's Warsaw office advised German laboratory testing service provider GBA Gesellschaft fur Bioanalytik on the acquisition of JARS S.A., a Polish company operating a chain of laboratories focusing on environmental analysis, foodstuffs, consumer goods, and pharmaceutical analysis. The target was advised by Gessel. | N/A | Poland | |
30-Dec | Studnicki, Pleszka, Cwiakalski, Gorski | Studnicki, Pleszka, Cwiakalski, Gorski successfully represented the minority shareholders of PGE Elektrownia Opole in a PLN 260 million dispute with PGE Gornictwo i Energetyka Konwencjonalna and PGE Polska Grupa Energetyczna before the Court of Appeal in Warsaw involving compensation for an improper determination of the share exchange parity in the process of merging the companies. | PLN260million | Poland | Here |
30-Dec | B2Rlaw; Gessel; Mrowiec Fialek & Partners | Mrowiec Fialek and Partners advised Custodia Capital on the acquisition of 100% of the share capital of Atende Software sp. z o.o. B2Rlaw advised the sellers. Gessel advised the remaining investors. | EUR11.6milion | Poland | |
30-Dec | Freshfields; King & Spalding; Latham & Watkins; Schoenherr | Schoenherr and Latham & Watkins advised AGRO Merchants Group on its sale to Americold Realty Trust. The buyers were advised by King & Spalding and Freshfields. | EUR1.48billion | Poland | |
31-Dec | Crido Legal; DWF | DWF advised the Corum XL investment fund on the acquisition of the Astris office building in Krakow. Crido advised the seller. | N/A | Poland | |
1-Jan | CMS; Dentons | CMS advised Panattoni, Marvipol, Bluehouse, and Kajima on their sale of a portfolio of logistics parks including Panattoni Park Poznan IV, Panattoni Park Szczecin II, Panattoni Park Warsaw North, Panattoni Park Warsaw South, and Panattoni Park Ruda Slaska I, to a fund represented by Savills Investment Management LLP. Savills was advised by Dentons. | N/A | Poland | |
20-Sep | Allen & Overy; CMS | CMS advised BGK on a revolving loan of up to up to PLN 500 million granted to Energa S.A. Energa was advised by Allen & Overy. | PLN500million | Poland | |
16-Dec | CMS; Dentons | CMS advised AFI Properties on the acquisition and financing of an office building located at 12 Marynarska street in Warsaw from Starwood Capital Group. Dentons advised the seller. | EUR100million | Poland | |
25-Aug | Jadek & Pensa; Prica & Partners; Rymarz Zdort | Rymarz Zdort, Jadek & Pensa, and Prica & Partners advised Innova Capital on the sale of 100% of the shares of subsidiary Trimo d.o.o. to Kingspan Group plc. | N/A | Poland; Serbia; Slovenia | Here |
12-Oct | Kochanski & Partners; Squire Patton Boggs | Kochanski & Partners and Squire Patton Boggs both claimed success in their representation of Poland's Muszynianka Spolka z Ograniczona Odpowiedzialnoscia and the Republic of Slovakia, respectively, in international arbitration initiated under the Agreement on the Protection and Promotion of Investments between the Slovak Republic and the Republic of Poland. | EUR170million | Poland; Slovakia | Here |
26-Mar | Baker Mckenzie (Esin Attorney Partnership); Caliskan Okkan Toker; Gessel | Gessel and Caliskan Okkan Tokker advised Polski Bank Komorek Macierzystych on its acquisition of 70% shares in the newly-created Famicord-Acibadem company. The Esin Attorney Partnership advised Acibadem on the transaction. | N/A | Poland; Turkey | Here |
10-Jan | Allen & Overy; CMS | CMS advised Bank Gospodarstwa Krajowego and KUKE S.A. on an export credit financing granted by BGK and insured by KUKE in relation to the development of the Nikolsky shopping mall in Kharkiv. Allen & Overy advised the borrower. | EUR53million | Poland; Ukraine | |
20-Jan | CMS | CMS advised Bank Pekao S.A. and KUKE S.A. on an export credit financing granted by Bank Pekao S.A. and insured by KUKE S.A. in relation to the development of a solar photovoltaic plant in Ukraine. | N/A | Poland; Ukraine | |
8-Jan | Peli Partners; Stratulat Albulescu | Stratulat Albulescu advised Romanian health & fitness chain World Class Romania on its lease of a 1500 square meter space in Bucharest's Expo Business Park for a new fitness club. The lessor was advised by Peli Partners. | N/A | Romania | Here |
8-Jan | Bulboaca & Asociatii | Bulboaca si Asociatii advised D Moonshots, an investment fund created by Sacha Dragic, the founder of the Superbet group, on its investment in tech start-up Medicai. | EUR500000 | Romania | Here |
15-Jan | Glodeanu & Associates | Glodeanu & Partners negotiated a lease agreement for Amrest with Romanian railway company Caile Ferate Romane to open a new Starbucks in Bucharest's Gara the Nord train station. | N/A | Romania | Here |
23-Jan | Popovici Nitu Stoica & Asociatii; PwC Legal (D&B David si Baias) | Popovici Nitu Stoica & Asociatii advised Swedish investment fund Oresa on the sale of its RTC Proffice Experience subsidiary, a stationery and office supplies company. D&B David si Baias advised the buyer, technology & communication producer and wholesaler Complet Electro Serv, which is part of the Altex group. | N/A | Romania | Here |
24-Jan | Stratulat Albulescu | Stratulat Albulescu advised Hagag on its acquisition of a 7013-square meter office building in Bucharest from NCH Capital. | N/A | Romania | Here |
28-Jan | Stratulat Albulescu | Stratulat Albulescu advised Bourbon Black Sea on its lease of 800 square meters of space in the Pipera Business Tower in Bucharest. | N/A | Romania | Here |
28-Jan | Mitel & Partners; Stratulat Albulescu | Stratulat Albulescu advised Bog'Art Residential on the acquisition of a 749 square meter land plot in Bucharest from an unnamed group of Spanish investors. Mitel & Partners advised the sellers. | N/A | Romania | Here |
29-Jan | Bondoc & Asociatii | Bondoc & Asociatii assisted McGuire Woods on the transformation and sale of its Romanian entity. | N/A | Romania | Here |
1-Feb | Allen & Overy; RTPR; Wolf Theiss | Wolf Theiss assisted VISMA AS with the acquisition of a 50.1% stake in Romania'sÊ Intelligent IT. RTPR and Allen & Overy advised the seller. | N/A | Romania | |
1-Feb | CMS; Wolf Theiss | Wolf Theiss advised OTP Bank Nyrt. And OTP Bank Romania S.A. on the EUR 27.4 million and RON 9,559,600 facilities granted to Cordia Parcului Residential Project. CMS advised the borrower. | EUR27.4million | Romania | |
6-Feb | Act (Botezatu Estrade Partners); Gide Loyrette Nouel; Leroy si Asociatii | Act | Botezatu Estrade Partners assisted Teva Pharmaceuticals on the accession by its Romanian subsidiary to the group's securitization programme, arranged by BNP Paribas, Dublin Branch. Leroy si Asociatii and Gide Loyrette Nouel advised BNP Paribas. | N/A | Romania | Here |
11-Feb | Cleary Gottlieb Steen & Hamilton; Clifford Chance; Filip & Company | Filip & Company advised RCS & RDS and Digi Communications N.V. on issuing two series of senior secured bonds. Clifford Chance Badea and Cleary Gottlieb Steen & Hamilton advised lead arrangers Citibank, ING Bank N.V., and UniCredit Bank S.A. | EUR850million | Romania | Here |
12-Feb | BPV Grigorescu Stefanica | BPV Grigorescu Stefanica advised Iveco Defense Vehicles, part of the CNH Industrial group of companies, on its sale of over 2900 high mobility trucks to the Romanian Ministry of National Defense for a total value of over EUR 700 million. | EUR700million | Romania | Here |
13-Feb | Stratulat Albulescu | Stratulat Albulescu advised Glory Global Solutions Ltd on Romanian law matters related to its investment in the Acrelec Group. | N/A | Romania | Here |
13-Feb | Clifford Chance; Filip & Company | Clifford Chance Badea advised a consortium of BNP Paribas, Citigroup Global Markets Limited, Raiffeisen Bank International AG, Societe Generale, and Unicredit Bank AG on the sovereign bond issuance by the Romanian Ministry of Finance on external markets. The Ministry of Finance was advised by Filip & Co. | EUR3billion | Romania | Here |
13-Feb | Stratulat Albulescu | Stratulat Albulescu advised Beez on its receipt of EUR 1.2 million funding from GapMinder Venture Partners and ROCA X. | EUR1.2million | Romania | Here |
13-Feb | Deloitte Legal (Reff & Associates) | Reff & Associates successfully represented a consortium of construction companies led by the Spanish firm Viales Y Obras Publicas SA Cuenca in an international commercial arbitration regarding the construction of road infrastructure based on a FIDIC contract. | EUR5million | Romania | Here |
15-Feb | Popovici Nitu Stoica & Asociatii | PNSA advised Senia Music on a public procurement tender organized by Gheorghe Dima Music Academy in Cluj-Napoca for the acquisition of several pianos. | N/A | Romania | |
17-Feb | Bulboaca & Asociatii; Clifford Chance | Clifford Chance Badea advised a syndicate of investment banks on the EUR 260 million high yield bonds issue of Frigoglass Finance B.V. Bulboaca & Asociatii advised Frigoglass. | EUR260million | Romania | |
21-Feb | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii assisted the AkzoNobel group on its inter-group merger of the company's Romanian subsidiary with the Fabryo Corporation. | N/A | Romania | Here |
24-Feb | Wolf Theiss | Wolf Theiss advised GlaxoSmithKline on Romanian aspects of a USD 9.8 billion joint venture agreement concluded with Pfizer, in order to create a new consumer health business. | N/A | Romania | |
28-Feb | Kinstellar; RTPR Allen & Overy | The Bucharest office of Kinstellar advised Highlander Partners on its acquisition of Sano Vita. RTPR Allen & Overy advised the sellers. | N/A | Romania | Here |
28-Feb | RTPR | RTPR advised Wyelands Capital, part of the Liberty Steel Group, on the acquisition of Romania's Banca Romana the Credite si Investitii from the Umbrarescu family. Solo practitioner Ana Maria Nistor advised the seller. | N/A | Romania | |
29-Feb | CEE Attorneys | CEE Attorneys/Boanta, Gidei si Asociatii advised Olympian Parks Group on a new joint venture between Olympian Park Group entities and a new Lebanese investor for the development and management of existing and new real estate projects to be raised by the JV business partners. | N/A | Romania | |
1-Mar | Deloitte Romania; Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asociatii advised Vodafone Romania on completing its absorption pf UPC Romania, as part of a take-over by Vodafone Group Plc of Liberty Global's operations in various countries, including Romania. Reff & Associates advised UPC Romania. | N/A | Romania | |
1-Mar | Eversheds Sutherland; Filip & Company; Wolf Theiss | Filip & Company assisted Alexander Barbut, Thomas Barbut, and Marcel Barbut on their sale of shares held in Adeplast S.A. to Switzerland's Sika AG group. Wolf Theiss advised Adeplast and Eversheds Sutherland advised Sika. | N/A | Romania | |
1-Mar | Wolf Theiss | Wolf Theiss advised Banca Comerciala Romana on the refinancing of the Hotel Cismigiu, which opened in 1912. | EUR7.2million | Romania | |
5-Mar | BPV Grigorescu Stefanica | BPV Grigorescu Stefanica successfully represented the Municipality of Bucharest in a dispute with two private companies involving the failure by its General Council to approve a Zonal Urban Plan. | EUR5million | Romania | Here |
5-Mar | White & Case | White & Case persuaded UK's Supreme Court to accept the petition of Romanian entrepreneur Ioan Micula and the companies in which he invested, enabling an action to enforce a 2013 ICSID arbitral award of approximately EUR 300 million, plus interest. | EUR300million | Romania | Here |
9-Mar | Willkie Farr & Gallagher; Wolf Theiss | Wolf Theiss and Willkie Farr & Gallagher advised CIP Capital on the acquisition of shares in the U.S.-based company 3Pillar Global, Inc., including the indirect acquisition of its Romanian subsidiary. | N/A | Romania | |
11-Mar | Kinstellar | Kinstellar advised First Farms on the acquisition of agricultural land from NCH Capital in Romania. | N/A | Romania | Here |
11-Mar | Leaua Damcali Deaconu Paunescu | Leaua Damcali Deaconu Paunescu and LALIVE successfully represented the interests of Romania before ICSID, which on March 5 rejected claims against Romania amounting to over RON 9 billion brought by Ioan and Viorel Micula. | RON9billion | Romania | Here |
15-Mar | CEE Attorneys | CEE Attorneys/Boanta, Gidei si Asociatii assisted the EMSA group with the exit of a former manager of its Aplast Wood Industry subsidiary. | EUR1.6million | Romania | |
19-Mar | Musat & Asociatii | Musat & Asociatii advised the EBRD on a EUR 16 million facility granted to the TeraPlast Group. | EUR16million | Romania | Here |
20-Mar | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii advised S&T on the acquisition of an integrated IT system for the issuance of civil status documents as part of an EU co-financed project). | EUR10million | Romania | |
23-Mar | Arcliffe | Arcliffe advised Italian energy company Alerion on the acquisition of a 100 MW wind energy project in Romania from unnamed Romanian sellers. | N/A | Romania | Here |
1-Apr | Laura Vladuca Law Office; Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asociatii advised Holde Agri Invest on its acquisition of Agromixt Buciumeni. The Laura Vladuca Law Office advised the seller. | N/A | Romania | |
1-Apr | Bondoc & Asociatii; CMS; Dechert | Bondoc si Asociatii, working alongside Dechert, advised Profi on the drafting and negotiation of addenda to the existing security agreement and relevant financing ancillary documentation for the grant of an additional facility by a group of new lenders.ÊCMS advised the banks | N/A | Romania | |
1-Apr | Morgan Lewis & Bockius; Wolf Theiss | Wolf Theiss heped Morgan, Lewis & Bockius provide advice on Romanian legislation to the Advanz Pharma Corp in regards to its prospective purchase of a Alprostadil pharmaceutical product portfolio from UCB Pharma Gmbh. | N/A | Romania | |
3-Apr | Leaua Damcali Deaconu Paunescu | Leaua, Damcali, Deaconu, Paunescu successfully represented Trammo GmbH in a case involving the question of whether, in the firm's words, "temporary seizure of assets can preclude an enforcement procedure conducted by another creditor." | N/A | Romania | Here |
3-Apr | Dobre Tulei si Asociatii; Schoenherr | Schoenherr advised Bucur SA on its entrance into a partnership with Romanian real estate developer Novum Business Invest. Dobre Tuley si Asociatii advised Novum Business Invest. | N/A | Romania | |
5-Apr | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii advised Deutsche Leasing Romania on the full implementation of the 4th AML Directive. | N/A | Romania | |
14-Apr | Deloitte Legal (Reff & Associates); Nestor Nestor Diculescu Kingston Petersen | Reff & Associates advised Forum Serdika, a Dutch financial holding group owned by British investment fund East Balkan Properties, on its sale of the Equest Logistic industrial park to CTP Bucharest. NNDKP advised the buyers on the deal.. | EUR30million | Romania | Here |
16-Apr | BPV Grigorescu Stefanica | BPV Grigorescu Stefanica successfully represented Mondialacqua SRL in a dispute over a utility model for a public water fountain technically similar to a Mondialacqua product. | N/A | Romania | Here |
1-May | Bondoc & Asociatii; Kinstellar; Latham & Watkins; White &Ê Case | Bondoc si Asociatii and White & Case advised agent and security agent Commerzbank Finance on financing provided to the buyer for its acquisition of All4Labels Global Packaging Group. Latham & Watkins was lead counsel to the borrower with Kinstellar advising on Romanian matters. | N/A | Romania | |
1-May | Iulia Malis Law Office; Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asociatii advised a syndicate of Banca Comerciala Romana, BRD Groupe Societe Generale, Raiffeisen Bank, and Banca Transilvania on its extension of a credit facility amounting to EUR 90 million that had been granted to MedLife, along with an additional EUR 20 million. The Iulia Malis Law Office advised MedLife. | EUR20million | Romania | |
4-May | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii advised the Romanian branch of BLOM Bank France on a EUR 5 million loan to Isaran, a real estate developer from Brasov, to finance the development of residential projects. | EUR5million | Romania | Here |
5-May | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii advised Libra Internet Bank on its establishment of a partnership with Monesse. | N/A | Romania | Here |
7-May | Furtuna si Asociatii | Furtuna si Asociatii represented the Romanian Airport Services handling company before the Romanian Competition Council regarding the abuse of dominant position investigation of the Avram Iancu Cluj International Airport. | N/A | Romania | Here |
12-May | Noerr | Noerr has advised the Bauer Media Group on the sale of its Romanian publishing business to Ringier. | N/A | Romania | Here |
18-May | Filip & Company | Filip & Company assisted Raiffeisen Bank on the May 14, 2020, listing of lei-denominated subordinated bonds on the Bucharest Stock Exchange. | RON480million | Romania | Here |
22-May | Stratulat Albulescu | Stratulat Albulescu successfully represented Hervis Sports & Fashion before a Specialized Tribunal in Cluj, winning an injunction for the deferred payment of part of the rent relating to the Vivo Shopping Center Cluj. | N/A | Romania | Here |
22-May | Deloitte Legal (Reff & Associates); DLA Piper | Reff & Associates advised the NH Hotel Group S.A. on Romanian aspects of a transaction which entailed two term loan facilities granted to it by undisclosed Spanish credit institutions. DLA Piper advised the lenders. | EUR225million | Romania | |
26-May | Buzescu Ca | Buzescu Ca successfully represented Alvogen IPCO S.a.r.l., and Alvogen Romania S.R.L. before the Bucharest Court of Appeals in their challenge to an application by Teva Pharmaceutical Industries Ltd. for a preliminary injunction against the sale of a drug Alvogen distributes. | N/A | Romania | Here |
27-May | Filip & Company | Filip & Company successfully represented Romania's Financial Supervisory Authority in a dispute against a former board member of the National Securities Commission involving labor and administrative issues worth over RON 1 million. | RON1million | Romania | Here |
29-May | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii advised Dedeman on the development and forward purchase of The Bridge 2 project, and on the development and forward purchase of The Bridge 3. | N/A | Romania | |
1-Jun | Noerr | Noerr advised on Bristol-Myers Squibb on its corporate restructuring and setting up of a new operational company and business restructuring related to the recent acquisition by BMS of Celgene. | N/A | Romania | |
1-Jun | Deloitte Legal (Reff & Associates); Wolf Theiss | Wolf Theiss assisted Ikea group member Ingka Investments on the staggered acquisition of 100% of the shares in seven portfolio companies in Romania, holding 171MW in nine wind farms. Reff & Associates advised the seller | N/A | Romania | |
1-Jun | Oliver Grimsley; Wilson Sonsini Goodrich & Rosati; Wolf Theiss | Wolf Theiss and Wilson Sonsini Goodrich & Rosati assisted MHC Software LLC in the acquisition of Romanian Ecrion Software International SRL. Oliver Grimsley advised the seller. | N/A | Romania | |
1-Jun | Filip & Company; Linklaters | Filip & Company, working alongside Linklaters, advised the Romanian Ministry of Public Finance on the issuance of Eurobonds in two tranches that raised EUR 3.3 billion from international markets. | EUR3.3billion | Romania | Here |
1-Jun | Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asociatii successfully defended Astra Vagoane Calatori in a dispute with the Bucharest Municipality regarding a public procurement procedure for the acquisition of 110 trams. | EUR176million | Romania | |
18-Jun | Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asocatii successfully represented the Romanian Tennis Federation, led by former world tennis star Ion Tiriac, against several challenges to the registration of the new board. | N/A | Romania | Here |
22-Jun | BPV Grigorescu Stefanica; CEE Attorneys | CEE Attorneys Boanta, Gidei si Asociatii advised the Sparking Capital investment fund on financing granted to the Romanian start-up K Factory. BPV Grigorescu Stefanica advised K-Factory on the deal. | N/A | Romania | Here |
23-Jun | Kinstellar | Kinstellar advised FirstFarms, a Denmark-based land and agriculture investor in Eastern Europe, on the sale of a farm covering approximately 1,700 hectares in Western Romania. | EUR11.4million | Romania | Here |
23-Jun | DLA Piper; Stratulat Albulescu | Stratulat Albulescu advised CODA Intelligence on a EUR 800,000 seed funding round led by Romanian Early Game Ventures and including technology investment fund ROCA X and other angel investors. DLA Piper advised Early Game Ventures on the deal. | EUR800000 | Romania | Here |
29-Jun | DLA Piper | DLA Piper advised Early Game Ventures on financing provided to Humans DNA, a Romanian startup developing the technology for generating synthetic media. ROCA X and other angel investors also participated in the EUR 330,000 financing round. | EUR330000 | Romania | Here |
30-Jun | Cazacu, Manolache, Popa | Cazacu, Manolache, Popa advised a Romanian subsidiary of Raiffeisen Leasing on the sale of a large plot of land in Aleea Viilor in Timisoara, Romania. | N/A | Romania | Here |
3-Jul | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii advised Warehouses De Pauw Romania on EUR 150 million facilities granted to it by the Bank for European Reconstruction and Development for financing the development of sustainable certified green logistic centers in Romania. | EUR150million | Romania | |
8-Jul | Radulescu & Musoi; Schoenherr | Radulescu & Musoi advised Black Sea Fund I on its acquisition of an unspecified stake in interior design and custom furniture company Intermedio General, which operates under the Theta brand. Schoenherr advised the seller. | N/A | Romania | Here |
9-Jul | CEE Attorneys; Digital 2 Law | CEE Attorneys Boanta, Gidei si Asociatii advised the Sparking Capital investment fund on the financing of Romanian start-up Questo. Digital 2 Law advised Questo on the deal. | N/A | Romania | Here |
13-Jul | EY Law (Radu Si Asociatii) | Acting on behalf of Chep Equipment Pooling NV, the tax litigation practice of Radu si Asociatii obtained a ruling from the Court of Justice of the European Union on the right of non-resident taxpayers to obtain VAT refunds. | N/A | Romania | Here |
15-Jul | CEE Attorneys | CEE Attorneys/Boanta, Gidei si Asociatii advised the Romanian subsidiary of the EMSA group, Bravo Europa, on an intra-group corporate restructuring project, consisting of the transfer of 100% ownership of the German and Czech subsidiaries of Bravo Europa. | EUR2.18million | Romania | |
16-Jul | Stratulat Albulescu | Stratulat Albulescu advised digital technology consulting company Brillio on the acquisition of Cognetik. | N/A | Romania | Here |
16-Jul | Zamfirescu Racoti Vasile & Partners | Zamfirescu Racoti Vasile & Partners successfully represented Banca Transilvania in a contract dispute before the Court of Justice of the European Union. | N/A | Romania | Here |
30-Jul | Clifford Chance; Jankovic Popovic Mitic; Schoenherr | Clifford Chance Badea advised the Kingspan Group, a company specialized in high-performance insulation and building envelope solutions, on the acquisition of TeraSteel SA, TeraSteel DOO Serbia, and Wetterbest SA. Schoenherr advised TeraPlast on the deal. | EUR85million | Romania | Here |
1-Aug | CEE Attorneys; DLA Piper | CEE Attorneys/Boanta, Gidei si Asociatii advised the Sparking Capital Venture Fund on a seed investment contract with Bright Spaces. DLA Piper advised Bright Spaces. | N/A | Romania | |
1-Aug | CEE Attorneys; Hamed Roman & Ion Andreea | CEE Attorneys/Boanta, Gidei si Asociatii advised Sparking Capital Venture Fund on a seed investment contract with EcoTree. Hamed Roman & Ion Andreea advised EcoTree. | N/A | Romania | |
1-Aug | CEE Attorneys | CEE Attorneys/Boanta, Gidei si Asociatii assisted Vertical Seven Group (Romanian venture capital fund focused on start-ups) in executing a seed investment agreement with EasySales. | N/A | Romania | |
1-Aug | CEE Attorneys | CEE Attorneys advised Moonlet on the launch of its cryptocurrency wallet, designed to store various types of crypto-assets. | N/A | Romania | |
1-Aug | CEE Attorneys | CEE Attorneys advised the FBCPA Crypto software platform on structuring its SaaS platform to ensure compliance with applicable regulatory requirements. | N/A | Romania | |
1-Aug | CEE Attorneys | CEE Attorneys/Boanta, Gidei si Asociatii advised Smartit Global, which operates the EasySales Platform, on the launch of DealWise. | N/A | Romania | |
4-Aug | Filip & Company | Filip & Company advised SoftwareONE Holding AG, a global provider of end-to-end software and cloud technology solutions, on the acquisition of B-lay, a provider of Software Asset Management advisory and managed services for SAP and Oracle solutions. Norton Rose Fulbright advised on Dutch and English Law. | N/A | Romania | Here |
10-Aug | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii successfully represented the interests of the Association of Romanian Construction Companies and several other large construction companies before the Bucharest Court of Appeal. | N/A | Romania | Here |
11-Aug | Zamfirescu Racoti Vasile & Partners | Zamfirescu Racoti Vasile & Partners successfully represented Intermed Consulting & Management before the High Court of Cassation and Justice of Romania in a case involving industrial park real estate tax exemption. | RON28million | Romania | Here |
17-Aug | BPV Grigorescu Stefanica | BPV Grigorescu Stefanica advised Romanian start-up Innoship on its acquisition of EUR 550,000 in seed funding from GapMinder VC. | EUR550000 | Romania | Here |
19-Aug | Stratulat Albulescu | Stratulat Albulescu successfully represented Romanian facility management company Compania Romprest Service S.A. in a dispute with the Ministry of European Funds in the Bucharest Court of Appeal. | N/A | Romania | Here |
24-Aug | Wolf Theiss | Adivising the European Fund For Southeast Europe S.A.,SICAV-SIFi on financing granted to Garanti BBVA Leasing to expand financing opportunities for micro and small enterprises in Romania. | EUR7million | Romania | |
31-Aug | Popovici Nitu Stoica & Asociatii | Popovici, Nitu, Stoica & Asociatii advised Belgian developer VGP Parks on the acquisition of 40 hectares of real estate in the Western Romanian city of Arad from an unnamed seller. | N/A | Romania | Here |
31-Aug | CEE Attorneys | CEE Attorneys/Boanta, Gidei si Asociatii advised start-up Ringhel on a round of seed financing through the crowdfunding platform SeedBlink. | EUR650.000 | Romania | |
31-Aug | CEE Attorneys | CEE Attorneys/Boanta, Gidei si Asociatii assisted food retailer Cora Romania during the company's share capital decrease (reduction of the client's share capital against accounting losses) of EUR 5.1 million, as part of net equity redressing process. | EUR6.5million | Romania | |
1-Sep | Biris Goran; Noerr | Noerr advised Doosan Heavy Industries & Construction on the acquisition byÊ Romanian investment fund SIF Banat-Crisana of a 99.92% stake in the Doosan IMGB industrial platform. Biris Goran advised the buyer. | N/A | Romania | |
1-Sep | CEE Attorneys | CEE Attorneys/Boanta, Gidei si Asociatii advised entrepreneur Andrei Cretu on his launch of the Pluria.co B2B platform, which offers access to an extended network of workspaces for company employees. | N/A | Romania | |
4-Sep | Deloitte Legal (Reff & Associates) | Reff & Associates advised Romania's Haier Tech on a refrigeration factory construction project in Prahova county, Romania. | N/A | Romania | Here |
4-Sep | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii advised Auchan in merger control proceedings before the Competition Council related to My Auchan proximity stores operating in Petrom gas stations. | N/A | Romania | |
4-Sep | CMS; Deloitte Legal (Reff & Associates); Herbert Smith Freehills; Wolf Theiss | CMS advised AFI Europe on its share acquisition of six companies owning four Class A office projects in Romania from NEPI Rockcastle. Herbert Smith Freehills and Reff & Associates - the Romanian member firm of Deloitte Legal - advised the seller. Wolf theiss advised the financing banks. | EUR300million | Romania | Here |
7-Sep | Kinstellar; PeliPartners | Kinstellar advised a joint venture of Resolution Property and Zeus Capital Management on its acquisition of the Floreasca Park office complex in Bucharest from GLL Real Estate Partners. PeliPartners advised GLL Real Estate Partners. | N/A | Romania | Here |
9-Sep | Deloitte Legal (Reff & Associates); Leroy si Asociatii | Leroy and Associates advised Groupe Rocher on its acquisition of Romania's Sabon cosmetics and toiletries retailer, and with subsequent merger control procedures before the Romanian Competition Council. Reff & Asociatii advised the seller. | N/A | Romania | Here |
9-Sep | Dentons | Dentons advised TC Capital on its EUR 20 million acquisition of a grain and oilseed farm from France's Gespie SAS. | EUR20million | Romania | Here |
10-Sep | Nestor Nestor Diculescu Kingston Petersen | NNDKP advised shareholders Gheorghe Iana and Vlad Ardeleanu on the sale of a majority stake in Medima Health to Morphosis Capital. Schoenherr's Bucharest office reportedly advised Morphosis Capital on the deal. | N/A | Romania | Here |
14-Sep | Popovici Nitu Stoica & Asociatii; Schoenherr | Popovici Nitu Stoica and Asociatii advised Auchan Retail Romania on its agreement with OMV Petrom to place 400 MyAuchan stores in the Petrom network of filling stations over the next five years. | N/A | Romania | Here |
15-Sep | Nestor Nestor Diculescu Kingston Petersen; Popovici Nitu Stoica & Asociatii; Schwartz & Asociatii | Popovici Nitu Stoica & Asociatii advised WDP, a Belgian developer and owner of logistics centers and warehousing, on the acquisition of the Aquila Logistics Centre in Cluj from _SNS Logistic Investment, the Craiova Logistics Centre in Dolj from Tamo-Ko Development SRL, and the Dunca Logistics Centre in Timis from Dunca Imobiliare. NNDKP advised SNS Logistic investment and Schwartz & Asociatii advised Tamo-Ko Development on those two deals. | N/A | Romania | Here |
17-Sep | Glodeanu & Associates | Glodeanu & Partners advised Blue Rock Investments on the acquisition of two logistic centers in Bucharest from unspecified sellers. | N/A | Romania | Here |
22-Sep | CEE Attorneys | CEE Attorneys / Boanta, Gidei si Asociatii advised Romanian entrepreneur Andrei Cretu on the launch of the Pluria B2B platform. | N/A | Romania | Here |
22-Sep | Popovici Nitu Stoica & Asociatii | PNSA advised Burda Group on the sale of its business in Romania to an unspecified buyer. | N/A | Romania | Here |
24-Sep | Bondoc & Asociatii | Bondoc & Asociatii advised Eviva Energy on the restructuring of an outstanding commercial debt owed to it by an unspecified renewable energy operator in Romania. | N/A | Romania | Here |
25-Sep | Filip & Company | Acting on behalf of Hidroelectrica, Filip & Co successfully persuaded the European Court of Justice to, in the firm's words, "confirm the free market status for all energy transactions by stating that imposing OPCOM as the sole transaction platform for producers is an unjustified restriction on the free movement of goods." | N/A | Romania | Here |
28-Sep | Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asociatii advised the Clever Business Transilvania media group on its acquisition of Prima TV in Romania. | N/A | Romania | Here |
30-Sep | Nestor Nestor Diculescu Kingston Petersen; Wolf Theiss | Wolf Theiss advised Artis Bio Tech SRL on the transfer of part of its business to a global manufacturer of dental implants. NNDKP advised the buyer. | N/A | Romania | |
1-Oct | Suciu Popa | Suciu Popa successfully represented Grup Feroviar Roman in its request that a bankruptcy claim filed against its subsidiary Rovit SA be dismissed. | N/A | Romania | Here |
2-Oct | MPR Partners | Maravela, Popescu & Asociatii | MPR Partners advised Interparking on its acquisition of the Bucur Obor Parking building in Bucharest from Parcaj Subteran Bucur Obor. | N/A | Romania | Here |
5-Oct | Noerr; Stratulat Albulescu; Taylor Wessing | Noerr advised Michael Jaffe, the insolvency administrator of Wirecard Sales International Holding GmbH, on the sale of all shares of its subsidiary Wirecard Romania SA to SIBS. Stratulat Albulescu and Taylor Wessing advised SIBS on the deal. | N/A | Romania | Here |
6-Oct | Popovici Nitu Stoica & Asociatii | PNSA advised Bico Industries and majority shareholder Mihai Birliba on the acquisition of a 30% stake in Bico by Roca Investments. | N/A | Romania | Here |
6-Oct | BPV Grigorescu Stefanica | BPV Grigorescu Stefanica advised the Hornbach Group on the development of a DIY mega-store in Oradea, Romania. | N/A | Romania | Here |
6-Oct | Filip & Company; Nestor Nestor Diculescu Kingston Petersen; Popovici Nitu Stoica & Asociatii | Filip & Co advised BCR on its sale of equal 33.3% stakes in the CIT One armored car company to BRD Groupe Societe Generale and Raiffeisen Bank Romania. PNSA advised BRD Groupe Societe Generale on the deal, while NNDKP advised Raiffeisen Bank Romania. | N/A | Romania | Here |
7-Oct | Stratulat Albulescu | Stratulat Albulescu advised Bog'Art Residential on the acquisition of two land plots in Bucharest from OMV Petrom S.A. | N/A | Romania | Here |
9-Oct | Digital 2 Law; Stratulat Albulescu | Stratulat Albulescu advised GapMinder Venture Partners on an unspecified investment in Cartloop, an eCommerce conversational marketing platform start-up. Digital 2 Law advised Cartloop. | EUR300000 | Romania | Here |
15-Oct | Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asociatii helped founders Florin Maxim, Eugen Zbircea, and Daniel Nanboe launch Comarket, a B2B marketplace for the Romanian hospitality industry. | N/A | Romania | Here |
16-Oct | Musat & Asociatii; NNDKP | NNDKP advised Romanian entrepreneur Daniel Boaje on the sale of his 10% stake in Premier Capital SRL and Premier Assets SRL to the Premier Capital Group. Musat & Asociatii advised the buyer on the deal. | N/A | Romania | Here |
16-Oct | BPV Grigorescu Stefanica | BPV Grigorescu Stefanica helped Forty Management obtain a license from U.S.-based Crystal Lagoons to develop the EUR 100 million Central District Lagoon City in Bucharest. | N/A | Romania | Here |
21-Oct | Bondoc & Asociatii | Bondoc & Asociatii advised Adient on the Romanian aspects of its global sale of its automotive fabrics manufacturing business, including its lamination business, to Sage Automotive Interiors. | USD175million | Romania | Here |
27-Oct | Go2Law; Mills & Reeve; RTPR; Vernon David & Associates | RTPR and Go2Law advised Innova Capital on its acquisition of PayPoint Services and Payzone from the PayPoint Group. Vernon David & Associates, working in cooperation with the UK's Mills & Reeve law firm, advised PayPoint on the deal. | N/A | Romania | Here |
28-Oct | Stratulat Albulescu | Stratulat Albulescu advised GapMinder Venture Partners and DayOne Capital on their joint investment in Romanian startup Soleadify. | N/A | Romania | Here |
30-Oct | DLA Piper; Orrick; Wilson Sonsini Goodrich & Rosati | Orrick advised GapMinder on its participation in the EUR 3 million Series Seed financing of Romanian start-up Deepstas. DLA Piper advised Deepstash and Wilson Sonsini Goodrich & Rosati advised Connect Ventures, another investor. | EUR3million | Romania | |
14-Nov | Popovici Nitu Stoica & Asociatii | Popovici Nitu Stoica & Asociatii advised the Estoria Group on the development and sale of a big-box retail facility, including a commercial gallery, to Leroy Merlin, Kaufland, and Lidl, in a series of transactions. | EUR20million | Romania | |
17-Nov | D'Ornano Partners; Dechert; Eversheds Sutherland; Freshfields; Norton Rose Fulbright; Popovici Nitu Stoica & Asociatii; Tuca Zbarcea & Asociatii | D'Ornano Partners, PNSA, and Norton Rose Fulbright advised the Orange Group on its EUR 268 million acquisition of a 54% stake in Telekom Romania from the OTE Group. Dechert and Eversheds Sutherland advised the OTE Group and Tuca Zbarcea & Asociatii advised Telekom Romania. | EUR268million | Romania | Here |
18-Nov | Allen & Overy; RTPR; Skils; Tuca Zbarcea & Asociatii | Radu Taracila Padurari Retevoescu and Allen & Overy advised Macquarie Infrastructure and Real Assets on its acquisition of the CEZ Group's Romanian assets. Skils and Tuca Zbarcea & Asociatii advised CEZ. | N/A | Romania | Here |
18-Nov | RTPR | Radu Taracila Padurari Retevoescu advised Mitiska REIM on its subsidiary's sale of property in Romania. | N/A | Romania | Here |
25-Nov | Kinstellar; Nestor Nestor Diculescu Kingston Petersen | NNDKP advised CTP on the acquisition of the A1 Bucharest Park from Cromwell Property, acting as the Central European Industrial Fund's intermediary. Kinstellar advised the seller on the deal. | N/A | Romania | Here |
26-Nov | BPV Grigorescu Stefanica; PeliPartners | BPV Grigorescu Stefanica advised Supernova on its acquisition of the Jupiter City Shopping Mall in Pitesti, Romania, from Mall Retail Rom. PeliPartners advised the seller on the deal. | N/A | Romania | Here |
26-Nov | Allen & Overy; RTPR; Simmons & Simmons; Zamfirescu Racoti Vasile & Partners | RTPR and Allen & Overy advised EximBank as the coordinating mandated lead arranger and a syndicate of Banca Comerciala Intesa Sanpaolo Romania, Banca Transilvania, CEC Bank, Garanti Bank, ING Bank's Bucharest Branch, International Bank for Economic Co-operation, OTP Bank Romania, Raiffeisen Bank Romania, and UniCredit Bank on the refinancing and maturity extension of a USD 150 million revolving facility granted to Romanian aluminum producer Alro. Zamfirescu Racoti Vasile & Partners and Simmons & Simmons advised the borrower on the deal. | EUR150million | Romania | Here |
1-Dec | Jinga & Asociatii; Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asociatii advised Engie Romania on its purchase of a photovoltaic park with an installed capacity of 9.3 MW from Ever Solar SA, a subsidiary of German photovoltaic park developer Soventix and developer Alpin Solar. Jinga & Asociatii advised Ever Solar. | N/A | Romania | |
1-Dec | Noerr | Noerr advised Messer Romania Gaz on its acquisition of 34% of the shareholding in Messer Energo Gaz SRL from Energomontaj SA and of 66% of the shareholding in Messer Energo Gaz SRL from Messer Group GmbH. | N/A | Romania | |
1-Dec | Bondoc & Asociatii; The Law Chamber | Bondoc si Asociatii assisted UCB Romania with the negotiation of a long-term lease agreement with One United Properties.ÊThe Law Chamber advised the owner. | N/A | Romania | |
1-Dec | CEE Attorneys | CEE Attorneys/Boanta, Gidei si Asociatii advised Olympian Parks Group on the acquisition of 60,000 square meter property for the purpose of extending the development of the Olympian Est Bucharest logistics and industrial park. | N/A | Romania | |
1-Dec | Schoenherr; Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asociatii advised coordinator, mandated lead arranger, documentation agent, facility and security agent Banca Comerciala Romana, along with mandated lead arrangers ING Bank N.V. Amsterdam, Bucharest Branch, Raiffeisen Bank SA, and OTP Bank Romania SA, on a EUR 51 million syndicated loan to Pehart, which is owned by Abris Capital Partners. Schoenherr advised Pehart/Abris Capital Partners. | EUR51million | Romania | |
1-Dec | DLA Piper; Tuca Zbarcea & Asociatii | Tuca Zbarcea & Asociatii advised entrepreneurs Bogdan Buta and Sveatoslav Veaceslav Vizitiu on the launch of an application called Extasy, including on an initial investment by the founders of EUR 500,000 and a subsequent pre-seed investment of EUR 350,000 from Early Game Ventures and entrepreneur Voicu Oprean. DLA Piper advised Early Game Ventures. | EUR850000 | Romania | |
3-Dec | D&B David and Baias; RTPR; Wolf Theiss | RTPR and D&B David si Baias advised shareholders Doina and Roxana Cepalis on the sale of Te-Rox Prod to Sweden's Holmbergs group. The Bucharest office of Wolf Theiss advised the buyer on the deal. | N/A | Romania | Here |
4-Dec | Nestor Nestor Diculescu Kingston Petersen; Stratula & Asociatii | Nestor Nestor Diculescu Kingston Petersen advised a syndicate consisting of Banca Comerciala Romana as the bookrunner, mandated lead arranger, documentation agent, and facility and security agent, CEC Bank as mandated lead arranger, and participating banks EximBank, Intesa Sanpaolo Romania, and OTP Bank Romania on an EUR 90 million loan facility to the Carmistin Group. Stratula & Asociatii advised the borrower on the deal. | EUR90million | Romania | Here |
9-Dec | Orrick; Stratulat Albulescu | Stratulat Albulescu, working alongside Orrick Herrington & Sutcliffe, advised GapMinder Venture Partners on a follow-on investment in Romanian start-up Deepstash. | N/A | Romania | Here |
14-Dec | Hogan Lovells; Schoenherr | Schoenherr advised Allianz-Tiriac on the acquisition of Gothaer Asigurari Reasigurari from the Gothaer Group. Hogan Lovells advised the Gothaer Group on the transaction. | N/A | Romania | Here |
14-Dec | PeliPartners; RTPR | RTPR advised the OLX Group on its acquisition of Kiwi Finance from Oresa Ventures. PeliPartners advised the seller on the deal. | N/A | Romania | Here |
15-Dec | Musliu & Asociatii; Nestor Nestor Diculescu Kingston Petersen | Nestor Nestor Diculescu Kingston Petersen advised Opel Groupe PSA on the sale of its Romanian business to Trust Motors, an independent importer for the Peugeot, Citroen, and DS brands. Trust Motors was advised by Musliu & Asociatii. | N/A | Romania | Here |
15-Dec | Hategan Attorneys; RTPR | RTPR advised 123FormBuilder and its shareholders Catalyst Romania, Florin Cornianu, and Adrian Gheara on attracting an investment from the 212 venture capital fund. Hategan Attorneys advised 212 on the deal. | N/A | Romania | Here |
15-Dec | Kinstellar; Pop Attorneys At Law | Kinstellar advised the Black Sea Fund I on the acquisition of Romanian dental imaging network DigiRay. Cluj-based Pop Attorneys at Law advised the seller on the deal. | N/A | Romania | Here |
16-Dec | Kinstellar; Peli Partners | Kinstellar advised S Immo AG on the acquisition of Campus Buildings 6.2 & 6.3 - two class A office buildings in Bucharest - from Skanska. Peli Partners advised Skanska on the deal. | EUR97million | Romania | Here |
17-Dec | Kinstellar; LC Legalproof | Kinstellar advised Romania's Mirus Group on the acquisition of Romania's Nexia CRG from shareholders Luminita Ristea, Silvia Elena Ichimescu, and Marioara Zaifu. LC Legalproof advised the sellers on the deal. | N/A | Romania | Here |
18-Dec | Bird & Bird; Stratulat Albulescu | Stratulat Albulescu, working alongside lead counsel Bird & Bird, advised Motion Equity Partners on its investment in Educastream. | N/A | Romania | Here |
22-Dec | Ijdelea Mihailescu | Ijdelea Mihailescu and software company Ringhel Team were contracted by the Romanian Energy Regulatory Authority to prepare a study on an energy supplier switch. | N/A | Romania | Here |
23-Dec | Suciu Popa | Suciu Popa successfully assisted Gianni Versace S.r.l., the owner of the Versace trademarks, with a series of judiciary and extra-judiciary procedures involving the defense of Versace's trademarks against an unauthorized producer and distributor based in the European Union. | N/A | Romania | Here |
23-Dec | Allen & Overy; Filip & Company; Kinstellar | Filip & Company helped RCS & RDS S.A. and the companies in its group, Digi Communications N.V., DIGI Tavkozlesi (RCS & RDS' Hungarian branch), Invitel Tavkozlesi Zrt, and DIGI Spain Telecom S.L.U. (RCS & RDS's Spanish branch) obtain two medium-term credit facilities worth a total of EUR 150 million and an incremental facility structure from a syndicate of Citigroup Europe plc - Dublin Romanian Branch, ING Bank N.V. Amsterdam Bucharest Branch, and Unicredit Bank S.A. Kinstellar and Allen & Overy advised the lenders. | EUR150million | Romania | Here |
29-Dec | Bondoc & Asociatii; CMS | CMS advised Hidroelectrica, the Romanian majority state-owned hydropower producer, on the acquisition of an operational 108 MW wind farm located in the Constanta county of Romania from Germany's STEAG group. Bondoc & Asociatii advised STEAG on the deal. | N/A | Romania | Here |
29-Dec | Filip & Company; Linklaters | Filip & Company, working with Linklaters, advised the Ministry of Public Finance of Romania in a two-tranche Eurobond issue that drew over EUR 2.5 billion from the international markets. | EUR2.5billion | Romania | Here |
29-Dec | CMS | CMS advised the National Bank of Greece on the disposal of a Romanian-risk corporate non-performing and sub-performing loan portfolio to a consortium composed of Bain Capital Credit and APS. | EUR174million | Romania | Here |
19-Nov | D&B David And Baias; Karanovic & Partners; Maravela, Popescu & Asociatii | MPR Partners helped J. Christof E&P Services S.R.L. and Christof Private Firefighting Services S.R.L. provide notification to Romanian and Serbian competition authorities of the economic concentration arising from OMV Petrom's externalization of several operations and general surface services ancillary to extraction and production of petroleum as well as natural gas, together with the relevant assets and dedicated staff. D&B David and Baias and Karanovic & Partners provided advice to J. Christof E&P and Christof Private Firefighting Services. | N/A | Romania; Serbia | Here |
8-Jan | Rustam Kurmaev & Partners | Rustam Kurmaev & Partners successfully represented Boris Dubrovskiy, the former governor of Russia's Chelyabinsk region, in a dispute with the Antimonopoly Service of Russia. | N/A | Russia | Here |
17-Jan | Egorov Puginsky Afanasiev & Partners | Egorov Puginsky Afanasiev & Partners helped BlaBlaCar to obtain clearance from Russia's competition authority for its purchase of Busfor, an online bus ticker aggregator. | N/A | Russia | Here |
30-Jan | Alrud; Orrik | Alrud, working alongside Orrick, advised the Soprema Group on its acquisition of 100% of both JSC Myagkaya Krovlya and JSC ET-Plast, which produce roofing and sound insulation products in Samara. | N/A | Russia | |
12-Feb | Liniya Prava | Liniya Prava is an official partner to Russia's "Great Heart" charity fund. | N/A | Russia | Here |
25-Feb | Bryan Cave Leighton Paisner | Bryan Cave Leighton Paisner advised Enisey THC, a subsidiary of the Siberian Generating Company, on its RUB 10 billion acquisition of Krasnoyarsk GRES-2 from OGK-2. | RUB10billion | Russia | Here |
27-Feb | Egorov Puginsky Afanasiev & Partners | Egorov, Puginsky, Afanasiev and Partners advised the Uralsoloto Group of Companies on its acquisition of securities of Petropavlovsk PLC. | N/A | Russia | Here |
27-Feb | White & Case | White & Case advised VTB Capital as auction organizer and financial advisor to UTLC on its RUB 60.3 billion auction of a controlling stake in Russian railway container operator TransContainer. | USD968million | Russia | Here |
28-Feb | Debevoise | Debevoise & Plimpton advised Norilsk Nickel on the upsizing and extension of its December 2017 syndicated facility agreement. | USD1.65billion | Russia | Here |
1-Mar | Alrud | Alrud advised Kernel Holding S.A. on the sale of a 50% stake in Taman Grain Terminal Holdings Limited. | N/A | Russia | |
12-Mar | Macfarlanes; Rybalkin, Gortsunyan & Partners | Rybalkin, Gortsunyan & Partners and Macfarlanes advised AEON Corporation on its sale of a 28.34% stake in Petropavlovsk Plc to the Yuzhuralzoloto Group. | N/A | Russia | Here |
18-Mar | Alrud; Integrites; Norton Rose Fulbright | Integrites and Switzerland's HFW law firm advised MUFG Bank and a syndicate of lending banks including Citi, Credit Agricole, and Societe Generale on a limited recourse term loan to finance Trafigura's acquisition of copper cathodes from the Swiss trading arm of the Russian mining group Norilsk Nickel. Trafigura was advised by Norton Rose Fulbright and Alrud. | N/A | Russia | Here |
19-Mar | Bryan Cave Leighton Paisner; Linklaters | Linklaters advised Sovcombank as arranger on the RUB 5.7 billion domestic green project bonds issued by an orphan special purpose vehicle, SFO RuSol 1 LLC, for the purpose of financing two of Solar Systems LLC's solar stations in the Astrakhan region of Russia. Bryan Cave Leighton Paisner advised the issuer. | RUB5.7billion | Russia | Here |
26-Mar | Stetom | Stetom advised Skoda Transportation on its entrance into a joint venture with Sinara-Transport Machines. The joint venture company, Sinara-Skoda, will be based in St. Petersburg, and will produce trams, trolleybuses and subway kits for the Russian market. | N/A | Russia | Here |
2-Apr | Alrud; Clifford Chance; WilmerHale | The Moscow office of Clifford Chance formed part of a multi-jurisdictional team helping GE obtain US and global merger clearance in connection with the USD 21.4 billion sale of its BioPharma business to Danaher, advised by WilmerHale and Alrud. | N/A | Russia | Here |
8-Apr | Bryan Cave Leighton Paisner | Bryan Cave Leighton Paisner advised PJSC RusHydro on that sale of a 90% shareholding in JSC International Energy Corporation to OJSC Hrazdan Power Company. As part of the transaction, OJSC refinanced MEK's debt obligations to the EBRD and the Asian Development Bank. | N/A | Russia | Here |
8-Apr | Kachkin & Partners | Kachkin & Partners successfully defended the interests of the Mamoshin Architectural Workshop in a dispute over the creation of a new stage at the Maly Drama Theater in St. Petersburg. | RUB22.4million | Russia | Here |
22-Apr | Baker Mckenzie | Lawyers in Baker McKenzie's Moscow office were part of the firm's multi-jurisdictional team advising arrangers and dealers Citi and J.P. Morgan and dealers Barclays, BofA Securities, and HSBC on the establishment of a USD 6.5 billion Global Medium Term Note program by VEON. | USD6.5billion | Russia | Here |
28-Apr | Baker Mckenzie; DLA Piper | DLA Piper advised Russian private equity firm Baring Vostok on the acquisition of a minority stake in Synergetic, a Russian manufacturer of environmentally friendly detergents and cosmetics. Synergetic was advised by Baker McKenzie. | N/A | Russia | Here |
30-Apr | White & Case | White & Case advised VTB Bank on the USD 1.7 billion restructuring of Russian mining and metal company Mechel PAO and on various matters connected to the related sale of the Elga Coal Complex, one of Mechel's main assets. | USD1.7billion | Russia | Here |
4-May | DLA Piper | DLA Piper advised Debex on the sale of a minority stake in the company to Dmitry Shushkin, the managing director of ABBYY Russia. | N/A | Russia | Here |
8-May | Alrud; Kirkland & Ellis; Slaughter and May; Weil, Gotshal & Manges | Alrud, working alongside Weil, Gotshal & Manges and Slaughter and May, advised Allergan plc. on the sale of shares to AbbVie. Kirkland & Ellis advised AbbVie. | USD63billion | Russia | |
11-May | Alrud; Monastyrsky, Zyuba, Stepanov & Partners | Alrud advised the Mechel Group on the sale of its 51% participatory interest in the companies which operate the Elga coalfield project in Russia to A-Property. Monastyrsky, Zyuba, Stepanov & Partners advised A-Property on the deal, which was valued at RUB 89 billion. | RUB89billion | Russia | Here |
14-May | Bryan Cave Leighton Paisner; TA Legal Consulting | Bryan Cave Leighton Paisner advised PJSC Sovcombank and Mobile Payments LLC on their entrance into a partnership with IDRAM LLC and IDBank CJSC, which were advised by TA Legal Consulting. | N/A | Russia | Here |
15-May | Alrud; Gibson, Dunn & Crutcher | Alrud and Gibson, Dunn & Crutcher advised Triton Partners on its acquisition of Lamina Technologies SA, a Swiss manufacturer of carbide cutting tools. | N/A | Russia | |
18-May | Akin Gump; Clifford Chance | Akin Gump advised PJSC Lukoil on its issuance of USD 1.5 billion Eurobonds listed on the Main Market of the London Stock Exchange. Clifford Chance advised joint lead managers Citigroup, Societe Generale CIB, and Bank GPB International S.A. (Gazprombank). | USD1.5billion | Russia | Here |
25-May | Debevoise & Plimpton | Debevoise & Plimpton is advising PAO TMK, a producer of tubular products for the oil and gas industry, on the repurchase of its regular shares by subsidiary Volzhsky Pipe Plant JSC, and on the prospective delisting of TMK's global depositary receipts from the London Stock Exchange. | USD300million | Russia | Here |
28-May | Vegas Lex | Vegas Lex won what it calls "two crushing victories" in the Arbitration Court of the North-Western District for pharmaceutical company Alium in disputes related to a contract for the construction of a large pharmaceutical plant. | N/A | Russia | Here |
28-May | Liniya Prava | Liniya Prava helped the VTB Group attract investors to Demeter Holding. | N/A | Russia | Here |
1-Jun | White & Case | White & Case advised Alliance Oil Company Ltd. on a tender offer and consent solicitation in respect of its USD 500 million 7.000% Guaranteed Notes due 2020. | USD500million | Russia | Here |
4-Jun | Clifford Chance | Clifford Chance advised the Russian Far East and Arctic Development Fund on a loan of RUB 5.7 billion (approximately USD 80 million) for the Amur hydrometallurgical plant, a subsidiary of Polymetal. | RUB5.7billion | Russia | Here |
9-Jun | Baker Mckenzie; Bryan Cave Leighton Paisner | Bryan Cave Leighton Paisner advised Kopy Goldfields AB on Russian matters related to its acquisition of authorized capital of the Russian gold mining company Amur Gold from HC Alliance Mining Group Ltd. and Lexor Group SA. Baker McKenzie advised the sellers. | N/A | Russia | Here |
11-Jun | Noerr | Noerr advised the Bauer Media Group on the sale of its interests in its Russian publishing companies to its current Russian management. The portfolio sold by BMG consists of interests in five Russian entities and around 90 magazines in total. | N/A | Russia | Here |
15-Jun | Herbert Smith Freehills; White & Case | White & Case advised Russian online video streaming service IVI on financing it received from Alfa Bank. Herbert Smith Freehills advised Alfa Bank on the deal. | N/A | Russia | Here |
23-Jun | Debevoise | Debevoise & Plimpton advised Sberbank on the acquisition of a 75% stake in 2GIS, an international digital maps and city guides company that provides "geo-information and hyperlocal services." | N/A | Russia | Here |
23-Jun | DLA Piper; Herbert Smith Freehills | DLA Piper advised Veon Holdings B.V.on the RUB 100 billion refinancing of its facilities with Russia's Sberbank. Herbert Smith Freehills advised Sberbank. | RUB100billion | Russia | Here |
29-Jun | Herbert Smith Freehills | Herbert Smith Freehills advised RusChemAlliance, a joint venture of Gazprom and RusGazDobycha, on the Baltic LNG integrated gas processing and LNG project. | N/A | Russia | Here |
30-Jun | Bryan Cave Leighton Paisner | Bryan Cave Leighton Paisner advised Sberbank Investments LLC on the acquisition of a 50% interest in Mayak LLC and Prima LLC, which are implementing projects related to the construction of a five-star hotel and apartments in Moscow. | N/A | Russia | Here |
1-Jul | Alrud; Morrison Foerster | Alrud and Morrison Foerster advised Taisho Pharmaceuticals Co., Ltd on the purchase of UPSA SAS and the acquisition of the certain assets of Bristol-Myers Squibb Company and its affiliates. | USD1.6billion | Russia | |
7-Jul | Liniya Prava | Liniya Prava assisted DNS Development with preparations for the first ever public-private partnership to build a school and kindergarten in the Primorsky Kraj territory of the Russian Far East. | N/A | Russia | Here |
10-Jul | CMS | CMS helped money transfer provider MoneyGram register as an operator of a foreign payment system with the Central Bank of the Russian Federation. | N/A | Russia | Here |
15-Jul | CMS | CMS Moscow successfully represented the interests of GE Healthcare in several court proceedings against the Russian healthcare regulatory authority Roszdravnadzor. | N/A | Russia | Here |
20-Jul | Egorov Puginsky Afanasiev & Partners | EPAM advised the VIS Group on the refinancing of a public-private partnership involving the construction of 12 social infrastructure facilities in Yakutsk through the placing of secured social bonds worth over RUB 5.6 billion. The refinancing was arranged by BKS, Otkritie Bank, DOM.RF Bank, and Sovcombank. | RUB5.6billion | Russia | Here |
23-Jul | Debevoise; Hogan Lovells | Debevoise & Plimpton advised the NLMK Group on a EUR 600 million revolving credit facility, with an accordion option allowing it to increase the funding limit up to EUR 1 billion. Hogan Lovells advised coordinating mandated lead manager ING Bank N.V. and mandated lead arrangers Credit Agricole Corporate and Investment Bank, NATIXIS, SGBTCI, AO Raiffeisenbank, Bank of America Merrill Lynch International Designated Activity Company, Mizuho Bank, Ltd., Deutsche Bank AG, London Branch, Bank ICBC (JSC), UniCredit S.p.A., and Intesa Sanpaolo Bank Ireland Plc . | EUR600million | Russia | Here |
27-Jul | Bryan Cave Leighton Paisner | Bryan Cave Leighton Paisner helped the PSA Group obtain Russian antitrust clearance for its merger with Fiat Chrysler Automobiles. | N/A | Russia | Here |
27-Jul | Ivanyan & Partners | Ivanyan & Partners represented the interests of the Russian Union of Railway Transport Operators and oil products transporter Transoil in antitrust proceedings against railway wheel manufacturer Vyksa Steel Works. | N/A | Russia | Here |
1-Aug | Alrud; DLA Piper | Alrud advised New Era Company LLC on the sale of its Vans retail business to VF International SAGL and VF CIS LLC. DLA Piper advised the buyers. | N/A | Russia | |
3-Aug | White & Case | White & Case advised the Moscow Exchange, Russia's largest securities exchange group, on its acquisition of a 17% stake in BierbaumPro AG and the right to acquire the rest from unidentified sellers. | N/A | Russia | Here |
11-Aug | Baker Mckenzie; Semenov & Pevzner | Baker McKenzie advised audio streaming service Spotify on its launch in 13 new markets, giving it a presence in 92 markets worldwide. Semenov & Pevzner advised Spotify on intellectual property issues related to its launch in the Russian market, as well as in Ukraine, Belarus, Moldova, and Kazakhstan. | N/A | Russia | Here |
12-Aug | White & Case | White & Case advised VTB Bank and a consortium of investors on the RUB 132 billion sale of a 55% stake in Tele2 Russia to Russia's Rostelecom, and on the acquisition of an approximately 29% stake in Rostelecom. | RUB132billion | Russia | Here |
14-Aug | Egorov Puginsky Afanasiev & Partners | Egorov Puginsky Afanasiev & Partners successfully represented Finland's Fortum energy company before the Russian government's commission on foreign investments and before Russia's competition authority with regard to the company's acquisition of a majority stake in Germany's Uniper. | N/A | Russia | Here |
20-Aug | Dentons | The St. Petersburg office of Dentons advised Power Machines on the reform of its intellectual property management system. | N/A | Russia | Here |
21-Aug | Egorov Puginsky Afanasiev & Partners | Egorov Puginsky Afanasiev & Partners helped The Chatterjee Group and Rhone Capital obtain approval from the Federal Antimonopoly Service of Russia for their acquisition of Lummus Technology from McDermott International. | N/A | Russia | Here |
21-Aug | Egorov Puginsky Afanasiev & Partners; Eversheds Sutherland | Egorov Puginsky Afanasiev & Partners and Eversheds Sutherland successfully protected the patent rights of Bayer in appellate proceedings before the Intellectual Property Court in Russia. | N/A | Russia | Here |
31-Aug | BGP Litigation | BGP Litigation successfully represented Irina Zhivova against her ex-husband in a post-divorce process regarding challenges to agreements involving property, children, and alimony. | N/A | Russia | Here |
1-Sep | Alrud; Tomashevskaya & Partners | Alrud advised Aram Davtyan on the acquisition by Up and Run LLC of 100% of A3 Sport LLC in return for a 20% share in the newly-merged Up and Run, which become a JV. Tomashevskaya & Partners advised Up and Run. | N/A | Russia | |
1-Sep | Alrud; Cooley; Morgan Lewis & Bockius; NautaDutilh | Alrud, NautaDutilh, and Cooley advised Uber B.V. on the contribution by Yandex N.V. of its car-sharing business to MLU B.V. as well as in connection with Yandex's restructuring of its self-driving business. Morgan, Lewis & Bockius advised Yandex. | N/A | Russia | |
7-Sep | Egorov Puginsky Afanasiev & Partners | Egorov Puginsky Afanasiev & Partners advised DynaEnergetics on the sale of its Russian subsidiary. | N/A | Russia | Here |
7-Sep | White & Case | White & Case advised Raiffeisenbank on a loan of up to USD 127 million to Rosvodokanal. | USD127million | Russia | Here |
8-Sep | Egorov Puginsky Afanasiev & Partners | Egorov Puginsky Afanasiev & Partners provided BNP Paribas Fortis Private Equity Belgium with a red flag analysis of contracts for the provision of freight forwarding and customs representative services and storage. | N/A | Russia | Here |
8-Sep | Egorov Puginsky Afanasiev & Partners | Egorov Puginsky Afanasiev & Partners advised US-based Clemco International, a manufacturer of air-powered abrasive blasting equipment, on IP, corporate, customs, and regulatory matters in Russia. | N/A | Russia | Here |
15-Sep | Debevoise | Debevoise & Plimpton advised longstanding client PJSC MMC Norilsk Nickel on its USD 500 million Eurobond offering. | USD500million | Russia | Here |
18-Sep | Hogan Lovells | Hogan Lovells advised Netflix on its partnership with Russia's National Media Group. | N/A | Russia | Here |
18-Sep | DLA Piper | DLA Piper advised Sberbank Investments on a secured mezzanine loan to Russia's Nizhny Novgorod Region and Prosveshcheniye Group for the construction of a training and educational center. | N/A | Russia | Here |
21-Sep | Debevoise; Rybalkin, Gortsunyan & Partners | Rybalkin, Gortsunyan & Partners, working with Debevoise & Plimpton and Henry King QC as part of PJSC Tatneft's legal team, successfully defended the right of Russian lawyers to claim attorney-client privilege in English court proceedings. | N/A | Russia | Here |
22-Sep | DLA Piper | DLA Piper advised the ADG group on the acquisition of Russian cinema operator Modern. | N/A | Russia | Here |
28-Sep | DLA Piper | DLA Piper advised VNV Global on its approximately USD 2 million investment in NaPopravku. | N/A | Russia | Here |
30-Sep | Egorov Puginsky Afanasiev & Partners | Egorov, Puginsky, Afanasiev & Partners helped aluminum producer Rusal register as a new resident of the Special Administrative Region on Oktyabrsky Island in the Kaliningrad region of Russia. | N/A | Russia | Here |
30-Sep | DLA Piper | DLA Piper been appointed as a legal partner to provide pro bono legal assistance to the Russian Chapter: the Russian hub for the global platform on climate change that operates under the auspices of the World Economic Forum's Climate Governance Initiative. | N/A | Russia | Here |
8-Oct | Eversheds Sutherland; Tomashevskaya & Partners | Eversheds Sutherland advised the Cherkizovo Group on its acquisition of Compas Foods LLC, a chicken processing facility in the Tula region of Russia that is a subsidiary of Cargill Inc. Tomashevskaya & Partners advised Cargill on the transaction. | N/A | Russia | Here |
15-Oct | Kachkin & Partners | Kachkin & Partners helped Russian general contractor STEP LLC reach a settlement with Pharmasintez-Nord JSC in a dispute regarding payment for work and related claims. | RUB100million | Russia | Here |
16-Oct | Hogan Lovells; White & Case | White & Case advised sole global coordinator and bookrunner Morgan Stanley & Co International on Mail.ru's US 200 million equity placing and further US 400 million convertible bonds offering due in 2025. Hogan Lovells provided legal advisory services to Mail.ru. | USD600million | Russia | Here |
20-Oct | Baker McKenzie | Baker McKenzie advised PJSC Koks on the issuance of new Eurobonds by subsidiary IMH Capital and a cash tender offer together with an exit consent solicitation to the holders of USD 500 million notes due 2022 issued by Koks Finance, another subsidiary of PJSC Koks. | USD350million | Russia | Here |
27-Oct | Egorov Puginsky Afanasiev & Partners | Egorov Puginsky Afanasiev & Partners successfully defended Ilya Averyanov, the former owner of the Menshevik Confectionary in South-Eastern Moscow, against charges that he murdered a guard at the factory. | N/A | Russia | Here |
27-Oct | Andrey Gorodissky & Partners | Andrey Gorodissky & Partners advised the founders of the "Kitchen in the District" service on their sale of an 87.4% stake in the company to O2O, a joint venture of the Mail.ru Group and Sberbank. | N/A | Russia | Here |
30-Oct | Egorov Puginsky Afanasiev & Partners; Goodwin Proctor | Egorov, Puginsky, Afanasiev & Partners, working alongside lead counsel Goodwin Procter, advised TA Associates on an unspecified investment in Netwrix Corporation. | N/A | Russia | Here |
30-Oct | Egorov Puginsky Afanasiev & Partners; White & Case | White & Case advised global coordinator and bookrunner VTB Capital on PJSC Aeroflot's fundraising of more than USD 1 billion. Egorov Puginsky Afanasiev & Partners advised Aeroflot on the deal. | RUB80billion | Russia | Here |
1-Nov | Alrud; Egorov Puginsky Afanasiev & Partners | Alrud advised indirect minority shareholders Elbrus Capital on the sale of 100% of Economy Development Center JSC to Teksa JSC. Egorov Puginsky Afanasiev & Partners advised the buyers. | N/A | Russia | |
1-Nov | Alrud; Shardul Amarchand Mangaldas & Co; Simpson Thacher & Bartlett | Alrud, Shardul Amarchand Mangaldas & Co, and Simpson Thacher & Barlett advised KKR on its acquisition of 54% stake in J.B. Chemicals & Pharmaceuticals Ltd. | N/A | Russia | |
3-Nov | Latham & Watkins; Linklaters | Latham & Watkins advised arranger and lender VTB Bank in connection with the GBP 3 billion take-private offer for KAZ Minerals PLC made by Nova Resources, a consortium formed by two of KAZ Minerals' largest shareholders. Linklaters advised KAZ Minerals on the deal. | GBP3billion | Russia | Here |
17-Nov | Clifford Chance; Debevoise | Clifford Chance advised BNP Paribas Personal Finance on the sale of its 20.8% stake in its Cetelem Bank joint venture to JV partner Sberbank. As a result of the deal, Sberbank, which was advised by Debevoise, became the sole shareholder of Cetelem Bank. | N/A | Russia | Here |
18-Nov | Korelsky Ischuk Astafiev | Korelsky Ischuk Astafiev advised founders Philip Ilyin-Adaev, Kirill Ilin-Adaev, and Elena Ishcheeva on the sale of their stakes in Banki.ru to Elbrus Capital and another unspecified investment fund. Dentons advised the buyer on the deal. | N/A | Russia | Here |
20-Nov | Semenov & Pevzner | Semenov & Pevzner successfully represented the interests of Domino's Pizza in the Russian city of Chelyabinsk in litigation against a former franchisee. | N/A | Russia | Here |
26-Nov | Egorov Puginsky Afanasiev & Partners | EPAM successfully represented ZMK 1520 in a dispute with New Forwarding Company over the replacement supply of railway wagons. | N/A | Russia | Here |
27-Nov | Hogan Lovells | Hogan Lovells advised Digital Assets on its acquisition of Zvuk, a Russian independent music streaming service. | N/A | Russia | Here |
1-Dec | Alrud; Slaughter and May | Alrud and Slaughter and May advised Trafigura on the acquisition of a 10% interest in Vostok Oil from Rosneft. | N/A | Russia | |
2-Dec | Debevoise; Latham & Watkins | Latham & Watkins advised the underwriters on the USD 1.1 billion initial public offering of Russian e-commerce platform Ozon Holdings PLC on Nasdaq. Debevoise & Plimpton advised Ozon Holdings on the deal. | USD1.1billion | Russia | Here |
3-Dec | Bryan Cave Leighton Paisner; Dentons | Bryan Cave Leighton Paisner advised Gazprom Neft PJSC on the creaion of Digital Industrial Platform, a joint venture with the Tsifra Group. Dentons advised the Tsifra Group on the deal. | N/A | Russia | Here |
3-Dec | Bryan Cave Leighton Paisner | Bryan Cave Leighton Paisner advised the HeadHunter Group, which operates Russian online recruiting platform hh.ru, on the acquisition of the Zarplata.ru online recruiting platform from Hearst Shkulev Digital Regional Network B.V. The transaction, which is valued at RUB 3.5 billion, already been given the requisite regulatory approval and is expected to close in January 2021. | RUB3.5billion | Russia | Here |
11-Dec | Bryan Cave Leighton Paisner | Bryan Cave Leighton Paisner advised Teva on the sale of a pharmaceutical company located in the Yaroslavl Industrial Park to Russia's R-Pharm Group. | N/A | Russia | Here |
14-Dec | DLA Piper | DLA Piper advised Sberbank Investments on its provision of a RUB 2 billion secured mezzanine loan to Russian construction company Avtoban to finance the construction of Startup Facilities No 3 and No 4 of the Central Ring Road in the Moscow Region. | RUB2billion | Russia | Here |
18-Dec | August Debouzy; Houthoff Cooperatief; Noerr | Noerr advised Axion Cyprus Holding Limited, a member of Russia's Softline Group, on its acquisition of a majority stake in Softline AG, a company listed on the open market segment of the Dusseldorf stock exchange, from its current major shareholder, Baden-Baden-based S.K. Management-und Beteiligungsgesellschaft mbH. Houthoff Cooperatief and August Debouzy also advised Axion on the deal. | N/A | Russia | Here |
21-Dec | Akin Gump; Linklaters | Akin Gump advised Equinor on its USD 550 million acquisition of a 49% stake in KrasGeoNaC from Rosneft. Linklaters's Moscow office advised the seller on the deal. | USD550million | Russia | Here |
22-Dec | Bryan Cave Leighton Paisner | Bryan Cave Leighton Paisner advised Gazpromneft-Snabzhenie on the establishment of the Iscource joint venture with Gazprombank. | N/A | Russia | Here |
22-Dec | Revera | Revera advised My.Games on its investments in Belarusian game development studios Mamboo Games, Appyfurious, and Purple Games. | N/A | Russia | Here |
23-Dec | Bryan Cave Leighton Paisner | Bryan Cave Leighton Paisner advised the ESN Group on the design and construction of a methanol plant in the Amur Region in Russia. | N/A | Russia | Here |
24-Dec | Gowling Wlg | Gowling WLG become a pro bono legal advisor to the Multimedia Art Museum in Moscow. | N/A | Russia | Here |
24-Dec | Orrick | Orrick advised JSC Sukhoi Civil Aircraft on its USD 1 billion sale, lease, and financing of a fleet of 31 Sukhoi Superjet 100 aircrafts to Ireland's CityJet. | USD1billion | Russia | Here |
28-Dec | DLA Piper; Rybalkin, Gortsunyan & Partners | Rybalkin Gortsunyan Partners advised the shareholders of Uchi.ru on the sale of a 25% stake in the educational platform, with an option of an increase to a controlling interest, to the Mail.ru Group and a consortium of investors formed by the Russian Direct Investment Fund and Russia-China Investment Fund. DLA Piper advised the buyers. | RUB3.75billion | Russia | Here |
29-Dec | Dentons | Dentons advised the Zyfra Group on its establishment of a joint venture with Gazprom Neft PJSC. | N/A | Russia | Here |
1-May | Alrud; Nagashima Ohno & Tsunematsu | Alrud and Nagashima Ohno & Tsunematsu advised Komatsu Ltd. on its acquisition of a majority stake in BOT Leasing Eurasia. | N/A | Russia | |
1-Dec | Akol Law Firm | The Akol Law Firm assisted VTB with suretyships granted by Ronesans Insaat for non-cash loans extended to Ronesans Construction JSC amounting to approximately RUB 70 billion. | RUB70billion | Russia, Turkey | |
1-Dec | Akol Law Firm | The Akol Law Firm assisted Sberbank with the facility agreements and surety agreements for loans granted to Yamata Endustriyel and Yamata Yatirim forÊ projects in Russia amounting to approximately EUR 200 million and RUB 2 billion. | EUR200millionandRUB2billion | Russia; Turkey | |
14-Dec | Durukan+Partners | Durukan+Partners advised Sovcombank PJSC on the USD 300 million financing to Rosatom subsidiary Akkuyu Nukleer A.S. for the Akkuyu NPP construction project, the first-ever nuclear power plant to be built in Turkey. | USD300million | Russia; Turkey | |
3-Aug | Alrud; Linklaters; Paul, Weiss, Rifkind, Wharton & Garrison; Slaughter and May | Alrud, Slaughter and May, and Paul, Weiss, Rifkind, Wharton & Garrison advised Elanco Animal Health Incorporated on its acquisition of 100% of Bayer's Animal Health Business. Linklaters advised Bayer. | USD6.9billion | Russia; Turkey; Ukraine | |
2-Mar | Redcliffe Partners; White & Case | Redcliffe Partners advised Takeda Pharmaceutical Company Limited on the sale of a portfolio of over-the-counter and prescription pharmaceutical assets to Acino. White & Case advised the seller. | USD200million | Russia; Ukraine | |
27-Oct | White & Case | Working pro bono, White & Case successfully represented a Crimean applicant in his request for asylum in the United States. | N/A | Russia; Ukraine | Here |
14-Jan | BDK Advokati; Samardzic, Oreski & Grbovic | BDK Advokati advised Biomin GmbH on the acquisition of Vinfeed doo, a Serbian distributor of animal nutrition products. The unidentified sellers were advised by Samardzic, Oreski, & Grbovic. | N/A | Serbia | Here |
17-Jan | Jankovic Popovic Mitic | JPM Jankovic Popovic Mitic provided legal support to Gastrans d.o.o., Serbia (a 100% subsidiary of a OAO Gazprom and Srbijagas joint venture) on the construction of Gazprom's 400 km long Turkish Stream gas pipeline through Serbia, which Srbijagas Director Dusan Bajatovic has recently declared complete. | N/A | Serbia | Here |
30-Jan | CMS | CMS advised Turkey's DenizBank and Ziraat Bank on a loan of approximately EUR 220 million granted to the Ministry of Construction, Transport, and Infrastructure of the Republic of Serbia for the design, construction, and/or reconstruction of the Novi Pazar-Tutin, Sremska Raca-Kuzmin, and Pozega-Kotroman sections of the motorway and a bridge over the River Sava. | EUR220million | Serbia | Here |
31-Jan | CMS | CMS Belgrade advised BMTS Technology on the opening of a manufacturing plant in Serbia. | EUR50million | Serbia | Here |
6-Feb | Andric Law Office; BDK Advokati; Dentons | BDK Advokati advised the shareholders of Serbian IT company Logo doo on the sale of a 60% stake to GetSwift. Dentons and Andric Law advised GetSwift on the deal. | N/A | Serbia | Here |
17-Feb | Karanovic & Partners | Karanovic & Partners advised Sweden's Backer AB on the acquisition of shares in Serbia's Elektrotermija d.o.o. | N/A | Serbia | Here |
1-Mar | Harrisons | Harrisons advised the EBRD on a senior loan to Banca Intesa ad Beograd. | EUR15million | Serbia | |
2-Mar | Zivkovic Samardzic | Zivkovic Samardzic advised Serbia's national commercial broadcaster B92, a subsidiary of the Kopernikus Corporation, on its transformation from a joint-stock company into a limited liability company. | N/A | Serbia | Here |
4-Mar | Zivkovic Samardzic | Zivkovic Samardzic advised Israeli company Sizmek Technologies Ltd. on Serbian aspects of Amazon's acquisition of Sizmek's ad serving and dynamic content optimization businesses. | N/A | Serbia | Here |
9-Mar | NKO Partners | NKO Partners advised Mercata, a Serbian distributor of fast-moving consumer goods, on its merger with Veletabak, a Serbian tobacco and consumer goods distributor. Veletabak was advised by solo practitioner Zeljko Marovic. | N/A | Serbia | Here |
23-Mar | Samardzic, Oreski & Grbovic | SOG advised Tesla on the launch of its first fast-charging station in Serbia. | N/A | Serbia | Here |
1-Apr | CMP Studio di Avvocati; Karanovic & Partners | Karanovic & Partners, working alongside Italian counsel CMP Studio di Avvocati, advised Gucci, a company incorporated in the Netherlands, on the acquisition of a 70% stake in Serbian shoe manufacturer F.lli Rossi Shoes doo. | N/A | Serbia | |
2-Apr | JSP Law; Samardzic, Oreski & Grbovic | Samardzic, Oreski & Grbobic advised Serbian construction and infrastructure company Compact Industry on its EUR 8 million construction deal with Swiss lighting manufacturer Regent Lighting. JSP Legal advised Regent Lighting on the deal. | EUR8million | Serbia | Here |
6-Apr | CMS | CMS, in cooperation with GFA Consulting Group, helped the EBRD prepare a tendering process for the Serbian City of Pirot for the selection of a private partner in a PPP project titled "Reconstruction and Maintenance of the Public Lighting System in the City of Pirot." | N/A | Serbia | Here |
15-Apr | JPM Jankovic Popovic Mitic | JPM advised the German School Belgrade on its implementation of a GDPR program. | N/A | Serbia | Here |
28-Apr | DLA Piper; Harrisons | Harrisons, working with DLA Piper as the global advisor, represented ALD S.A. and Mitsubishi UFJ Lease & Finance Company Limited before the Commission for Protection of Competition of the Republic of Serbia in its attempt to obtain approval for the concentration which will occur as a result of its creation of a joint venture in Malaysia with MUL. | N/A | Serbia | |
25-May | BDK Advokati | BDK Advokati has been appointed to act as the local representative for Google under the Serbian Data Protection Act. | N/A | Serbia | Here |
26-May | Samardzic, Oreski & Grbovic | Samardzic Oreski & Grbovic advised Bravos Holding on the acquisition of a high-class office building in Belgrade from DUTB. | N/A | Serbia | Here |
26-May | NKO Partners | NKO Partners advised Dr. Max, the largest pharmacy network in Central Europe, on a public-private partnership project involving the concession of 27 state owned pharmacies located in the City of Krusevac and the Rasina District of Serbia. | N/A | Serbia | Here |
27-May | Karanovic & Partners; NKO Partners | Karanovic & Partners advised Canadian precious and base metals exploration company Tethyan Resource Corp on its acquisition of ten percent of the shares and management control over the of the Serbian geological company EFPP. NKO Partners advised EFPP on the deal. | N/A | Serbia | Here |
27-May | NKO Partners | NKO Partners advised industrial real estate developer CTP on its EUR 2.1 million acquisition of six hectares of land in Kragujevac, Serbia, from the City of Kragujevac. | EUR2.1million | Serbia | Here |
1-Jun | Harrisons | Harrisons acted as Serbian legal counsel to the EBRD on a loan to Eurobank ad Beograd under the COVID-19 Resilience Framework to be on-lent to eligible sub-borrowers. | EUR40million | Serbia | |
1-Jun | Harrisons | Harrisons advised the EBRD in relation to a senior unsecured loan to ProCredit Bank Serbia ad Beograd. The loan shall be used for on-lending to eligible beneficiaries in Serbia. | EUR40million | Serbia | |
1-Jun | Harrisons | Harrisons advised the EBRD in relation to senior loan to UniCredit Bank Serbia under the COVID-19 Resilience Framework. | EUR75million | Serbia | |
3-Jun | Kinstellar | Kinstellar advised Korea's Kyungshin Cable on the construction of a 12,000-square-meter factory in the Serbian town of Smederevska Palanka. | EUR20million | Serbia | Here |
3-Jun | NKO Partners | NKO Partners advised Lola Real Estate on its acquisition of 9,376 square meters of land in a public tender procedure from the Belgrade Land Agency, then advised Lola Real Estate sole shareholder Loran Soco on the sale of the company to the Czech Republic's UDI Group. Sole practitioner Aleksandra Nedeljkovic advised UDI on the latter deal. | EUR7million | Serbia | Here |
15-Jun | JPM Jankovic Popovic Mitic | JPM helped Gastrans d.o.o. Novi Sad draft the Natural Gas Transmission System Network Code, which, with the consent of the Energy Agency of the Republic of Serbia, entered into force on May 30, 2020. | N/A | Serbia | Here |
16-Jun | Karanovic & Partners | Karanovic & Partners advised Serbian IT company 3Lateral on its EUR 7.7 million acquisition of a 6,500-square-meter lot from the City of Novi Sad. | EUR7.7million | Serbia | Here |
23-Jun | JPM Jankovic Popovic Mitic | JPM Jankovic Popovic Mitic advised sellers Milija Babovic and Apsara on the sale of a 67% stake in the Victoria Group to the MK Group. | N/A | Serbia | Here |
29-Jun | NKO Partners | NKO Partners helped Konica Minolta Serbia, a part of a Japanese multinational technology company, obtain a favorable judgment from the Administrative Court of Serbia, which annulled a fine previously levied against the company by the Serbian Competition Commission for allegedly entering into restrictive agreements. | N/A | Serbia | Here |
1-Jul | Freshfields; Karanovic & Partners | Karanovic & Partners, working with international counsel Freshfields, advised Guangdong Wencan Die Casting Co. on its acquisition of Le Belier. | N/A | Serbia | |
1-Jul | Harrisons; Reed Smith | Harrisons, working with lead counsel Reed Smith, advised the EBRD in relation to a loan to Coral SRB doo Beograd to finance the expansion of Shell-branded gas stations and implement energy efficiency and environmental solutions. | EUR10million | Serbia | |
1-Jul | Harrisons | Harrisons acted as legal counsel to the EBRD in relation to two loans to Erste Bank Serbia for the purpose of making sub-loans in accordance with the SME Policy Statement. | EUR60million | Serbia | |
2-Jul | Zivkovic Samardzic | Zivkovic Samardzic achieved a victory in the Appellate Court in Belgrade for the Crime and Corruption Reporting Network (KRIK), a non-profit organization established to improve investigative journalism in Serbia. | N/A | Serbia | Here |
3-Jul | CMS; Nko Partners | NKO Partners advised industrial real estate developer CTP on a EUR 16.5 million financing for its real estate projects in Serbia from Raiffeisen Bank Serbia. CMS advised Raiffeisen Bank on the transaction. | EUR16.5million | Serbia | Here |
6-Jul | Bojovic Draskovic Popovic & Partners | Bojovic Draskovic Popovic & Partners is advising PEPCO on its plans to enter the Serbian market. | N/A | Serbia | Here |
6-Jul | Clifford Chance; Harrisons; Stephenson Harwood | Harrisons represented Al Dahra and ADQ before the Commission for Protection of Competition of the Republic of Serbia in its application for approval for the concentration that will occur as a result of ADQ's acquisition of 50% of the share capital and voting rights of Al Dahra. Stephenson Harwood was the global adviser on competition matters to Al Dahra while Clifford Chance was the global adviser on competiton matters to ADQ. | N/A | Serbia | |
22-Jul | PR Legal | PR Legal successfully defended the interests of coffee producer and manufacturer Strauss Adriatic in a dispute over the alleged infringement of the "C Kafa" trademark. | EUR45000 | Serbia | Here |
4-Aug | CMS; NKO Partners | NKO Partners advised CTP on financing of EUR 13.5 million from the EBRD for real estate project development in Serbia. CMS advised the EBRD on the transaction. | EUR13.5million | Serbia | Here |
7-Aug | Bojovic Draskovic Popovic & Partners; JPM Jankovic Popovic Mitic | Jankovic Popovic Mitic advised French multinational company C.D Holding Internationale SAS on its EUR 5 million acquisition of an additional stake in Emergo Sport d.o.o., the Serbian subsidiary of Fitpass Limited. Fitpass was advised by Bojovic, Draskovic, Popovic, and Partners. | EUR5million | Serbia | Here |
19-Aug | Jankovic Popovic Mitic | Jankovic Popovic Mitic helped sporting good retailer Intersport S Trgovina doo comply with the Serbian Data Protection Act. | N/A | Serbia | Here |
21-Aug | NKO Partners | NKO Partners advised BizLink Holding on what the firm calls an intercompany restructuring that resulted in the company becoming the sole shareholders of its subsidiary, BizLink Serbia. | N/A | Serbia | Here |
25-Aug | Karanovic & Partners | Karanovic & Partners provided its analysis of the Serbian railway freight transport market to the World Bank Group and the Serbian Competition Commission regarding. The firm's analysis was provided as part of the Program for Improving the Business Environment in Serbia. | N/A | Serbia | Here |
26-Aug | BDK Advokati | BDK Advokati advised the EBRD and the Enterprise Expansion Fund on a EUR 12 million secured credit facility loan to High Tech Engineering Center, a software developer and technology research and development service provider in Serbia. | EUR12million | Serbia | Here |
27-Aug | Mikijelj Jankovic & Bogdanovic | Mikijelj, Jankovic & Bogdanovic successfully represented the interests of Serbian TV hosts Zoran Kesic and Ivan Ivanovic before the Press Council of Serbia regarding an alleged violation of the Code of Ethics of Serbian Journalists by daily newspaper Telegraf and the news portal Republika.rs. | N/A | Serbia | Here |
10-Sep | Mikijelj Jankovic & Bogdanovic | Mikijelj Jankovic & Bogdanovic advised the Belgrade-based Nelt Grupa on its acquisition of baby food brand Bebi from Atlantic Grupa. | N/A | Serbia | Here |
14-Sep | CT Legal; Zivkovic Samardzic | Zivkovic Samardzic advised Manchester-based biotech firm APIS Assay Technologies Ltd on the Serbian aspects of its acquisition of BeoGenomics. CT Legal advised the unnamed seller of BeoGenomics on the deal. | N/A | Serbia | Here |
22-Oct | Fieldfisher; LMS Studio Legale; Prica & Partners | Prica & Partners as Serbian counsel and LMS Studio Legale Milano as Italian counsel have advised Ferrero on Serbian merger clearance aspects related to Ferrero's acquisition of Fox's Biscuits. Fieldfisher advised CTH Invest, a Belgian holding group associated with Ferrero Group, on the underlying acquisition. | N/A | Serbia | Here |
3-Nov | NKO Partners | NKO Partners helped Belgrade Waterfront open the Galerija Belgrade shopping center byÊassistingÊBelgrade Waterfront in drafting and negotiating all lease agreements for the shopping mall, including those with anchor tenants. | N/A | Serbia | Here |
3-Nov | Harrisons | Harrisons advised the EBRD on its EUR 20 million loan to Banca Intesa Beograd. | EUR20million | Serbia | Here |
5-Nov | Harrisons | Harrisons advised the EBRD on an EUR 25 million loan, which will be matched by Raiffeisen Banka Beograd, to Sojaprotein. AP Legal advised Raiffeisen Banka on the deal. | EUR25million | Serbia | Here |
11-Nov | Karanovic & Partners | Karanovic & Partners helped set-up Ventu.rs, the first Serbian crowd-investing platform. | N/A | Serbia | Here |
13-Nov | Schoenherr | Schoenherr advised Serbian holding company Delta Holding on its acquisition of Sava Centar from the City of Belgrade. | N/A | Serbia | |
16-Nov | Jankovic Popovic Mitic | Jankovic Popovic Mitic helped chemical company BASF implement GDPR best practices in Serbia. | N/A | Serbia | Here |
20-Nov | BDK Advokati; Gernhandt & Danielsson Advokatbyra KB; Sunjka Law | BDK Advokati, working alongside Sweden's Gernandt & Danielsson Advokatbyra KB, advised the Embracer Group AB on the acquisition of all issued shares of Mad Head Games d.o.o., a game development studio in Novi Sad, Serbia. Sunjka Law advised Mad Head Games shareholders Nenad Tomic, Uros Banjesevic, and Aleksa Todorovic on the deal. | N/A | Serbia | Here |
26-Nov | Zivkovic Samardzic | Zivkovic Samardzic was appointed the representative of SNAP Inc. under the Serbian Data Protection Act, following a decision by the Commissioner for Information of Public Importance and Personal Data Protection. | N/A | Serbia | Here |
27-Nov | Andric Law Office; Dentons; Schoenherr | Dentons advised Umweltbank Aktiengessellschaft, GLS Gemeinschaftsbank EG, and two investment funds managed by Triodos Investment Management on the acquisition of a majority stake in Opportunity Banka a.d. Novi Sad from Opportunity Transformation Investments inc. Andric Law Office provided Serbian advice to the buyers, and Schoenherr advised Opportunity Transformation Investments. | N/A | Serbia | Here |
1-Dec | Zivkovic Samardzic | Zivkovic Samardzic was appointed the representative for Yandex LLC pursuant to the Serbian Data Protection Act, following a decision by the Commissioner for Information of Public Importance and Personal Data Protection of Serbia. | N/A | Serbia | Here |
3-Dec | Andrejic & Partners; NKO Partners | NKO Partners advised CTP Invest on its acquisition of a part of Eyemaxx Real Estate's portfolio in Serbia. Andrejic & Partners advised the seller. | N/A | Serbia | |
3-Dec | Harrisons | Harrisons advised the EBRD on Serbian law matters related to a loan to Intesa Leasing doo Beograd. | EUR10million | Serbia | |
15-Dec | BDK Advokati | BDK Advokati advised Affidea Diagnostic B.V. on the sale of Affideal Special Hospital in Belgrade to Medigroup System. | N/A | Serbia | Here |
16-Dec | CMS; Jankovic Popovic Mitic | Jankovic Popovic Mitic advised BASF on the sale of its Construction Chemicals business in Serbia to an affiliate of private equity firm Lone Star. | N/A | Serbia | Here |
22-Dec | NKO Partners | NKO Partners advised the BizLink Group on its EUR 3.5 million acquisition of a commercial property and production facilities in Prokuplje, Serbia, from Gama Investor Solutions. Attorney-at-law Aleksandar Kuljak advised the seller on the deal. | EUR3.5million | Serbia | Here |
23-Dec | Samardzic, Oreski & Grbovic | Samardzic, Oreski, Grbovic been appointed AiCure's data protection representative in Serbia by the Commissioner for Information of Public Importance and Personal Data Protection. | N/A | Serbia | Here |
25-Dec | Bopa Bojanovic Partners; Markovic Vukotic Jovkojic; Schoenherr | Schoenherr advised Oaktree Capital Management on its acquisition of Serbian edible oil business Victoriaoil from the Victoria Group. Bopa Bojanovic Partners and Markovic Vukotic Jovkojic advised the seller. | N/A | Serbia | |
31-Dec | Kinstellar | Kinstellar advised Croatia's Arena Hospitality Group on the acquisition by its Serbian subsidiary of the 88 Rooms Hotel in Belgrade. | EUR5.95million | Serbia | |
1-May | Harrisons | Harrisons advised the EBRD on a senior secured loan granted to Javno Gradsko Saobracajno Preduzece Novi Sad, a public transport company fully owned by the City of Novi Sad to finance the acquisition of 30 compressed natural gas buses. | EUR7million | Serbia | |
1-Jun | Harrisons | Harrisons advised the EBRD on a senior loan granted to Sabac District Heating Company to finance the implementation of energy efficiency measures in up to 40 residential multi-storey buildings in the City of Sabac. | EUR2.5million | Serbia | |
14-Jan | Allen & Overy; Stanek Verak & Partners | Allen & Overy advised Vseobecna Uverova Banka on the sale and leaseback of a real estate portfolio. Stanek Verak & Partners advised the buyer. | N/A | Slovakia | |
23-Jan | EY Law; Noerr | Noerr advised NEI, an Indian bearings manufacturer and exporter, on its acquisition of international bearings producer Kinex Bearings and bearing trading company Global Supply. The sellers were advised by Ernst & Young. | N/A | Slovakia | Here |
24-Jan | CMS; MCL | MCL advised MiddleCap Real Estate Ltd. on its acquisition, reconstruction, and development of the Gorkeho 4 office project and subsequently on the sale of the project to Kooperativa Insurance company, a member of the Vienna Insurance Group. Kooperativa Insurance was advised by CMS. | N/A | Slovakia | Here |
5-Mar | Kinstellar | Kinstellar advised Hungary-based financial group OTP Bank on the sale of its 99.44% stake in its Slovak operations to Belgium's KBC Group. | N/A | Slovakia | Here |
11-Mar | Kinstellar; Skubla & Partneri | Kinstellar advised Austrian company European City Estates on its acquisition of the Rosum office complex in Bratislava from Penta Real Estate, which was advised by Skubla & Partneri. | N/A | Slovakia | Here |
11-Mar | Havel & Partners; Schoenherr | Havel & Partners advised GTH Catering a.s., a company in the portfolio of the Genesis Capital fund, on its entry to the Slovak market and on its acquisition of Sodexo s.r.o., the Slovak subsidiary of French group Sodexo. Schoenherr advised the seller. | N/A | Slovakia | |
24-Mar | Cechova Partners; Chiomenti; Nctm Studio Legale | Cechova Partners, working with Chiomenti, advised on the acquisition of part of the Noovle group, including the indirect acquisition of Noovle Slovakia. Nctm Studio Legale advised the sellers | N/A | Slovakia | |
31-Mar | PRK Partners | PRK Partners advised co-lead managers J&T Banka (which also acted as arranger), Ceska Sporitelna, Komercni Banka, and UniCredit Bank Czech Republic and Slovakia on the preparation of the base prospectus and other documentation for a senior secured bonds issuance by EPH Financing. | CZK7.5billion | Slovakia | |
17-Apr | Dentons; Majernik & Mihalikova | Majernik & Mihalikova advised Livedispatcher and its founders on the sale of their entire shareholding to REEF Technologies. The buyers were advised by Dentons. | N/A | Slovakia | |
22-Apr | White & Case | White & Case advised lead managers Ceskoslovenska Obchodna Banka, Slovenska Sporitel'na, and Tatra Banka on the Slovak Republic's issuance of EUR 1.5 billion 1.000% notes due in 2030. | EUR1.5billion | Slovakia | Here |
1-May | Allen & Overy; Capitol Legal Group | Allen & Overy represented ZSE Energia, a.s. in a dispute initiated by the European Institute for Consumer Protection regarding the manner of charging the "tariff for system operation" to electricity end consumers. Capitol Legal Group represented the EICP. | N/A | Slovakia | |
13-May | Majernik & Mihalikova | Majernik & Mihalikova advised Proer, which is developing a solution for testing air quality, and its founders, on an investment received from the Crowdberry fund. | N/A | Slovakia | |
28-May | White & Case | White & Case advised lead managers Barclays Bank, Citigroup Global Markets Limited, Deutsche Bank AG, HSBC, and Intesa Sanpaolo Group member Vseobecna Uverova Banka on the Slovak Republic's dual tranche issuance of EUR 2 billion 0.250% notes due 2025 and EUR 2 billion 1.000% notes due 2032. | EUR4billion | Slovakia | Here |
10-Jun | Bohm & Partners; Havel & Partners | Havel & Partners advised Deutsche Telekom group member Slovak Telekom a.s. on the sale of Zoznam s.r.o. Bohm & Partners advised the buyer. | N/A | Slovakia | |
15-Jun | Bartosik Svaby; Majernik & Mihalikova | Majernik & Mihalikova advised Groupsolver, on raising of capital in Slovakia. Bartosik Svaby advised investor Eterus Capital.. | N/A | Slovakia | |
9-Jul | Bartosik Svaby | Bartosik Svaby advised the Eterus Capital fund on its EUR 1.5 million acquisition of a 12.36% stake in Eyerim. | EUR1.5million | Slovakia | Here |
22-Sep | Freshfields; Kinstellar | Kinstellar advised E.ON on its acquisition of a 49% stake in electric utility Vychodoslovenska Energetika Holding from the German's RWE. Freshfields Bruckhaus Deringer advised the seller on the deal. | N/A | Slovakia | Here |
29-Oct | Majernik & Mihalikova | Majernik & Mihalikova advised Powerex, a company developing smart grid solutions, and its founder, on an investment into the company by Manifesto. | N/A | Slovakia | |
30-Oct | Dentons; Relevans | Dentons advised Vseobecna Uverova Banka and UniCredit Bank on a EUR 105 million loan to J&T Real Estate for the construction of the Eurovea Tower in Slovakia. Relevans advised the unidentified borrower on the deal. | EUR105million | Slovakia | Here |
6-Nov | Dentons | Dentons helped petitioners obtain three favorable rulings from the Constitutional Court of the Slovak Republic. | N/A | Slovakia | Here |
17-Nov | Havel & Partners | Havel & Partners advised Vision Ventures on its investment in Slovakian start-up Eatster, which operates an online food order application. | N/A | Slovakia | Here |
16-Dec | Majernik & Mihalikova | Majernik & Mihalikova advised on the sale of shares in SEC Technologies, a fast-growing scale up developing laser based detectors of chemicals, between its shareholders. | N/A | Slovakia | |
14-Jan | Rojs, Peljhan, Prelesnik & Partners; Selih & Partners | Selih & Partnerji advised Supernova on its EUR 220 million acquisition of seven shopping malls and five smaller shopping centers from Centrice Real Estate GmbH, a member of America's Lone Star fund. The sellers were advised by Rojs, Peljhan, Prelesnik & Partnerji. | N/A | Slovenia | Here |
26-Feb | Law Firm Prodan Juric; Miro Senica | Miro Senica represented Petrol d.d. in its acquisition of 100% of electricity distributor E-3 d.o.o. from Elektro Primorska. The Law Firm Prodan Juric advised the seller. | N/A | Slovenia | |
23-Mar | ODI Law | ODI Law advised Agromarket's local Slovenian entity on its acquisition of Semenarna Ljubljana from Dezelna Banka Slovenije. | N/A | Slovenia | Here |
3-Apr | Jadek & Pensa; Kavcic Bracun & Partners; Wolf Theiss | Jadek & Pensa advised Abanka on its acquisition by NKBM from the Republic of Slovenia. NKBM was advised by Wolf Theiss, while Kavcic, Bracun & Partners advised the seller. | N/A | Slovenia | Here |
22-Apr | Linklaters; ODI Law | ODI Law worked alongside lead counsel Linklaters in advising cryptocurrency software development and research company nCHAIN on its acquisition of CREA, a Slovenia-based software development firm. | N/A | Slovenia | Here |
30-Jun | Miro Senica | Miro Senica advised Heba investicije d.o.o. on its purchase of a vacant building plot intended for a shopping center, as well as on the construction agreement and building permit issuance. | EUR916220 | Slovenia | |
9-Jul | ODI Law | ODI Law advised Hranilnica Lon on a new issuance of shares. | N/A | Slovenia | Here |
20-Sep | N/A | Miro Senica represented subcontractor IMP, d.d. in a dispute with the main contractor for the construction of the "Olympic Centre Koper" project, consisting of an Olympic swimming pool, football field, and other sports and administration facilities, involving the contractor's withholding payment of EUR 900,000 out of a total of EUR 2.2 million due to alleged defects. | EUR900000 | Slovenia | |
1-Oct | Cooley; Miro Senica | Miro Senica was engaged by American company Vertica Capital Partners to perform legal and tax due diligence of Slovenian IT company Bunnyway d.o.o. related to its intended acquisition of an 80% stake in Bunnyway, although the transaction did not go forward due to commercial issues. Cooley advised on US law. | N/A | Slovenia | |
30-Dec | Clifford Chance; Poellath; Schoenherr | Schoenherr and Poellath, working alongside Clifford Chance, advised Deutsche Private Equity on Slovenian matters related to its acquisition of a majority stake in Mehler Vario System, a Germany-based manufacturer of bulletproof vests and protective systems, from Munich-based industrial holding firm Armira. Shearman & Sterling advised the seller. | EUR21million | Slovenia | |
| | Shearman & Sterling | $ 0 | | |
1-Jan | Turkey | Akol Law Firm; Allen & Overy; Linklaters | TheAkolLawFirmandLinklatersassistedTurkiyeSinaiKalkinmaBankasiA.S.witha144A/RegSplacementofUSD350millionsustainableEurobondswith5-yearmaturitywhichwasunderwrittenbyCitiINGStandardCharteredBNPParibasCommerzbankBankABCandSMBCNikko.ThejointleadmanagerswereadvisedbyAllen&Overy. | USD 350 million | |
9-Jan | Turkey | Pelister Atayilmaz Enkur; Taboglu | ThePelisterAtayilmazEnkurLawOfficeadvisedtheHoshizakiCorporationonitsacquisitionof28.6%ofsharesinOztiryakilerMadeniEsyaSanayiveTicaretviaasharetransferfromtheOztiryakilerfamilyandthesubscriptionofnewsharesfollowingacapitalincreaseinOzti.TheOztiryakilerfamilywasadvisedbyTabogluAttorneysatLaw. | N/A | Here |
15-Jan | Turkey | Ozbek Attorney Partnership; Turunc | TuruncadvisedBigChefsonitsacquisitionofTurkey'sNumNumcafe/restaurantchainfromtheIsGirisimprivateequityfundandChefMehmetGurs.ThesellerswereadvisedbytheOzbekLawFirm. | N/A | Here |
4-Feb | Turkey | Bezen & Partners | Bezen&PartnerssuccessfullyrepresentedTurkishfootballplayerOmerKerimAliRizainadisputewiththeTurkishFootballFederationbeforeTheEuropeanCourtofHumanRights. | N/A | Here |
4-Feb | Turkey | Gibson, Dunn & Crutcher; Paksoy; Winston & Strawn | PaksoyworkedalongsideglobalcounselWinston&StrawninadvisingDanfossA/SaDanishmanufacturerofheattransfersolutionsonitsacquisitionofEatonCorporation'shydraulicsbusiness.Gibson&DunnadvisedEatononthetransaction. | USD 3.3 billion | Here |
21-Feb | Turkey | Paksoy | PaskoyadvisedNovartisonthesaleofoneofSandozTurkey'smanufacturingfacilitiestoTurkishpharmaceuticalcompanyGenericaIlac. | N/A | Here |
28-Feb | Turkey | Baker Mckenzie (Esin Attorney Partnership); Gide Loyrette Nouel (Ozdirekcan Dundar Senocak) | GideLoyretteNoueladvisedGroupamaHoldingFilialesetParticipationsonthesaleandtransferofits10%stakeinTurkishinsurancecompanyGunesSigortaA.S.toTVFFinansalYatirimlarAnonimSirketiasubsidiaryoftheTurkeyWealthFund.BakerMcKenzieadvisedTVFonthetransaction. | N/A | Here |
31-Mar | Turkey | Guden Law Firm | TheGudenLawFirmadvisedTurkishpetroleumexporterBDYGroupYatirimA.S.onquestionsrelatedtotheimpactofthegrowingCOVID-19crisisontheircompany'smastersaleandpurchaseagreements. | N/A | Here |
31-Mar | Turkey | Akol Law Firm; DLA Piper | TheAkolLawFirmworkingwithDLAPiperadvisedbothsidesonTurkishmattersrelatedtoDanaher-GeneralElectric'sUSD21.4billionglobalsaleofBiopharma. | N/A | |
1-Apr | Turkey | Akol Law Firm; Herbert Smith Freehills; White & Case | TheAkolLawFirmworkingwithHerbertSmithFreehillsassistedChevroninthedisposalofinterestsintheAzeriChiragandDeepWaterGunashlifieldandBaku-Tbilisi-CeyhanpipelinetoMOLHungarianOilandGasPublicLimitedCompany.White&CasewasglobaltransactioncounseltoMOL. | USD 1.57 billion | |
24-Apr | Turkey | Aksan; BTS & Partners; Kolcuoglu Demirkan Kocakli; Turunc | TuruncadvisedELBAHRInsanKaynaklariEgitimveDanismanlikAnonimSirketi(doingbusinessas"Peoplise")anditsfoundingshareholdersontheacquisitionof86.7%ofthecompanyfromthemandRevoCapitaland500StartupsbyLOGO.YazilimSanayiveTicaretA.S.BTS&PartnersandAksanadvisedRevoCapitaland500StartupsrespectivelyandKolcuogluDemirkanKockaliadvisedLOGO. | N/A | Here |
1-May | Turkey | Akol Law Firm | TheAkolLawFirmassistedTarimKrediHoldingandits12groupcompanieswithaforcedinitialpublicoffering. | N/A | |
5-May | Turkey | Allen & Overy; Turunc; Yuksel Legal | TuruncadvisedYu-CeMedicalanditsshareholdersCengizBalcikandYumnuBalcikontheacquisitionoftheremaining28%ofYu-CesharesfromtheAnatoliaGrowthCapitalFund.YukselLegalandAllen&OveryadvisedtheAnatoliaGrowthCapitalFundonthedeal. | N/A | Here |
12-May | Turkey | Linklaters; Paksoy | PaksoyandLinklatersadvisedISquaredCapitalLLPonitsindirectacquisitionof45%ofthesharesinRubisTerminal. | N/A | Here |
2-Jun | Turkey | BTS & Partners; Ilhanli Baser | BTS&PartnersadvisedTurkishlogisticscompanyYoldaanditsfoundersontheirreceiptofaninvestmentofUSD835000fromCollectiveSparkaninvestmentfundfocusingontechcompaniesandvariousangelinvestors.IlhanliBaseradvisedCollectiveSparkontheinvestment. | USD 835,000 | Here |
3-Jun | Turkey | Abcoo; Baker Mckenzie; Baker Mckenzie (Esin Attorney Partnership); BTS & Partners; Dentons; Dentons (Baseak); GKC Partners; Verdi Law Firm; White & Case | White&CaseanditsassociatedTurkishfirmGKCPartnersadvisedinteractiveentertainmentcompanyZyngaInc.onitsUSD1.8billionacquisitionofIstanbul-basedPeakOyunYazilimvePazarlamaA.S.BakerMcKenzieworkingwithitsTurkishaffiliatetheEsinAttorneyPartnershipadvisedPeakonthetransaction.DentonsalongwithitsaffiliateBalciogluSelcukArdiyokKekiAvukatlikOrtakligiadvisedHummingbirdVenturesCVAastheinvestorseller.BTS&PartnersadvisedEndeavourCatalystasaninvestorsellerandAbcoohadadvisedPeakFounderandCEOSidarSahin. | USD 1.8 billion | Here |
10-Jun | Turkey | Allen & Overy; Gedik & Eraksoy | Allen&OveryandGedik&EraksoyadvisedStandardCharteredBankandBankofAmericaasarrangersofanESG-linkedsyndicatedloanfacilityforTurkey'sGarantiBBVA. | N/A | Here |
15-Jun | Turkey | BTS & Partners; Norton Rose Fulbright; Norton Rose Fulbright (Inal Kama Attorney Partners) | BTS&PartnersadvisedtheshareholdersofmobilepaymentandbanktransferserviceproviderPayguruonthesaleof100%ofitssharestoTpayMobile.NortonRoseFulbrightLondonandtheInalKamaAttorneyPartnershipadvisedTpayMobileonthedeal. | N/A | Here |
26-Jun | Turkey | BTS & Partners | BTS&PartnersadvisedtheGrowthCircuitventurecapitalfirmonanunspecifiedinvestmentinInvidyo-adeveloperofchildmonitoringdevicesthatrelyonartificialintelligence. | N/A | Here |
8-Jul | Turkey | BTS & Partners; Uysal Law Firm | BTS&PartnersadvisedQNBeyondVenturestheventurearmofQNBFinansbankonanunspecifiedinvestmentincloud-basedaccountingsoftwareandfinancialapplicationplatformKolaybi.TheUysalLawFirmadvisedKolaybi'sshareholdersincludingitsfoundersandHUBVentureCapital. | N/A | Here |
8-Jul | Turkey | Cakmak | CakmakadvisedLandesbankBaden-WurttembergandKfWIPEX-BankGmbHonthefinancingof132MWPhase2investmentinLodosKaraburunElektrikUretimA.S'swindfarmintheIzmirprovinceofTurkey. | USD 134.5 million | Here |
10-Jul | Turkey | Caliskan Okkan Toker; Travers Smith; Turunc | TheTuruncLawFirmworkingalongsideTraversSmithrepresentedMicroFocusinitsacquisitionofAtarLabsfromfoundersBurakDayiogluMuratToraandGokhanSayandinvestorDiffusionCapitalPartners.ThesellerswererepresentedbyCaliskanOkkanToker. | N/A | Here |
15-Jul | Turkey | Akol Law Firm; CMS (Yalcin Babalioglu Kemahli Attorney Partnership); Turunc; Yondem Yigit Uclertopragi | TheTuruncLawFirmadvisedagroupofprivateinvestorsledbyCetinYilmazontheiracquisitionofMCI'smajoritystakeinonlinetravelagencyTatilbudurfromPolishprivateequityfundMCI.TheYalcinBabaliogluKemahliAttorneyPartnershipadvisedMCIonthedealwhileAkolLawadvisedshareholderIsGirisim.TatilbudurwasadvisedbyYondemYigitUclertopragi. | N/A | Here |
22-Jul | Turkey | Cooley; Moroglu Arseven; Rajah & Tann; Turunc | TuruncandCooleyadvisedUS-basedprivateequityfundRiverwoodCapitalonitsinvestmentinInsideragrowthmanagementplatformfordigitalmarketers.RiverwoodledtheUSD32millioninvestmentroundwhichincludedparticipationfromSequoiaWamdaandEndeavorCatalyst.MorogluArsevenandRajah&TannadvisedInsider. | USD 32 million | Here |
24-Jul | Turkey | Aksan | AksanadvisedPaketMutfakGayrimenkulIsletmeciligiveHizmetleriAnonimSirketianditsshareholdersonitslatestinvestmentround. | N/A | Here |
24-Jul | Turkey | Dentons; Dentons (BASEAK); Herguner Bilgen Ozeke | BalciogluSelcukAkmanKekiAttorneyPartnershipadvisedAnatoliaB.V.asubsidiaryofagriculturalexporterTiryakiAgroFoodsIndustryonthesaleof25.58%shareholdinginSunriseFoodsInternationalInc.toHassadHoldingsCanada.DentonsadvisedTiryakionEnglishlawmattersandHergunerBilgenOzekeadvisedHassadHoldings. | N/A | Here |
24-Jul | Turkey | Kinstellar | KinstellaradvisedVivenseanditsCEOandfounderKemalErolonaUSD130millioninvestmentintothecompanybytheActeraGroupaprivateequityfirmfocusingoninvestmentsinTurkey. | USD 130 million | Here |
1-Aug | Turkey | Akol Law Firm | TheAkolLawFirmassistedTSKBwiththeapproximatelyEUR17millionfinancingofthe9.8MWInegol-22.312MWOrduzuand2.4MWKapikayaBiogasPowerPlantProjectsrealizedbyDoguStar(adirectsubsidiaryofBiotrendandanindirectsubsidiaryofDoganlarYatirimHolding). | EUR 17 million | |
1-Aug | Turkey | Akol Law Firm | TheAkolLawFirmassistedTSKBwiththeapproximatelyEUR8millionfinancingofthe4.2MWBergamaBiogasPowerPlantProjectrealizedbyIzmirDoguStar(adirectsubsidiaryofBiotrendandanindirectsubsidiaryofDoganlarYatirimHolding). | EUR 7 million | |
1-Aug | Turkey | Akol Law Firm | TheAkolLawFirmassistedTSKBwiththeapproximatelyEUR3millionfinancingofthe2.4MWInegol-1BiogasPowerPlantProjectrealizedbyNovtekEnerji(adirectsubsidiaryofBiotrendandanindirectsubsidiaryofDoganlarYatirimHolding). | EUR 3 million | |
1-Aug | Turkey | Akol Law Firm | TheAkolLawFirmassistedTSKBwiththeapproximatelyEUR20millionfinancingoftheSimayWindPowerPlantprojectrealizedbySimayElektrik(ownedbyNoktaYatirimHoldingandYilsanYatirimHolding). | USD 20 million | |
1-Aug | Turkey | Akol Law Firm | TheAkolLawFirmassistedTSKBwiththeapproximatelyUSD7.5millionfinancingforDoganlarYatirimHolding'sacquisitionofMavenEnerjishares. | USD 7.5 million | |
1-Aug | Turkey | Akol Law Firm | TheAkolLawFirmassistedTSKBwiththeapproximatelyUSD3.5millionfinancingofthe2.8MWSivasBiogasPowerPlantProjectrealizedbyNovEnerji(adirectsubsidiaryofBiotrendandanindirectsubsidiaryofDoganlarYatirimHolding). | USD 3.5 million | |
5-Aug | Turkey | Aksan | Turkey'sAksanLawFirmadvisedAlbarakaAssetManagementonitsinvestmentinClotieane-commercecompanythatprovidespersonalizedclothingservices. | N/A | Here |
6-Aug | Turkey | BTS & Partners | BTS&PartnersadvisedTechOneVentureCapitalandTwozeroVenturesfundsmanagedbyActusAssetManagementonanunspecifiedinvestmentinFineDineDigitalMenusforRestaurantsCafes&Bars. | N/A | Here |
11-Aug | Turkey | Dentons; TOCC Attorney Partnership | TheTOCCAttorneyPartnershipadvisedAkbanksubsidiaryAKLeaseonitsEUR40millionfinancingfromtheEBRD.DentonsreportedlyadvisedtheEBRDonthedeal. | EUR 40 million | Here |
12-Aug | Turkey | Caliskan Okkan Toker; GKC Partners; White & Case | White&CaseanditsassociatedTurkishfirmGKCPartnersadvisedZyngaInc.onitsUSD168millionacquisitionofan80%stakeinRollicamobilegamesdeveloperandpublisherfromMehmetCanYavuzDenizBasaranBurakVardalVolkanBicerMehmetAyanandYunusEmreGonul.CaliskanOkkanTokeradvisedthesellersonthedeal. | USD 168 million | Here |
24-Aug | Turkey | AK Law Firm; Paksoy; Schulteriesenkampff | PaksoyandGermany'sSchulteriesenkampfflawfirmadvisedImerysontheacquisitionbyitssubsidiaryCalderysDeutschlandGmbHofa60%stakeintheHaznedarGroupfromseveralindividualshareholders.TheAKLawFirmadvisedthesellersonthedeal. | N/A | Here |
24-Aug | Turkey | BTS Partners | BTSPartnersadvisedQnbeyondventuresonanunspecifiedinvestmentinIkasasoftware-as-a-servicescommerceplatformforsmall-and-mediumenterprises. | N/A | Here |
25-Aug | Turkey | Gun & Partners; Moral & Partners | Moral&PartnersadvisedTaximCapitalonitsacquisitionofDoganayGidaaTurkishmanufacturerofnon-carbonatedbeveragessaucesandvinegars.Gun&Partnersadvisedtheunidentifiedsellers. | N/A | Here |
28-Aug | Turkey | Moral & Partners | Moral&PartnersadvisedtheminorityshareholdersofTurquoiseYacht-formerlyknownasProteksan-onthesaleof40%ofthesharesofthecompanytotheAlBarwaniGroup. | N/A | Here |
2-Sep | Turkey | Akol Law Firm | TheAkolLawFirmadvisedCizmeciTimeontheacquisitonofaproductionandstoragefacility. | N/A | |
4-Sep | Turkey | BTS & Partners; EY Legal (KS Attorney Partnership) | BTS&PartnersadvisedthefoundersofEnteknoGlobalandDiffusionCapitalPartnersonCrodaInternationalPlc.'srecentGBP1.5millionacquisitionofaminoritystakeinthecompany.TheKSAttorneyPartnershipthelocallegalarmofEYTurkeyadvisedCrodaonthedeal. | GBP 1.5 million | Here |
8-Sep | Turkey | Cakmak; Paksoy | CakmakadvisedVoodooonanunspecifiedinvestmentinFabrikaGames.PaksoyadvisedFabrikaGamesonthedeal. | N/A | Here |
14-Sep | Turkey | Bezen & Partners | Bezen&PartnersadvisedMBUAEInvestmentLLConitsbuy-outofminorityshareholdersinthecompany'sTurkishsubsidiaries. | N/A | Here |
14-Sep | Turkey | Akol Law Firm | TheAkolLawFirmadvisedGarantiBankonanapproximatelyEUR62millionfinancingfortheacquisitionofSesaAmbalajbyanindirectSPVofDoganHolding. | EUR 62 million | |
14-Sep | Turkey | Akol Law Firm; Kolcuoglu Demirkan Kocakli | TheAkolLawFirmadvisedDoganHoldingsubsidiaryOncuGirisimSermayesiYatirimOrtakligia.s.onitsindirectacquisitionof70%ofSesaAmbalajvePlastikSanayiTicaretA.S.KolcuogluDemirkanKocakliadvisedthesellers. | EUR 58 million | |
13-Oct | Turkey | Erdem & Erdem | Erdem&ErdemadvisedtheSisecamGrouponitsacquisitionoffiveTurkishcompanies:AnadoluCamDenizliCamPasabahceSodaSanayiiandTrakyaCam. | N/A | Here |
16-Oct | Turkey | HS Attorney Partnership | HSAttorneyPartnershipadvisedPoland'sSterSp.z.o.oonitsacquisitionof51%ofthesharesofFourceKoltukSistemlerifromshareholdersKorayUcarNedimGulerandTuncerCevik. | N/A | Here |
21-Oct | Turkey | Akol Law Firm; Clyde & Co; Kolcuoglu Demirkan Kocakli | TheAkolLawFirmadvisedGlobalPortsHoldingPlconthesaleofa99.9%stakeinPortAkdenizacommercialportinAntalyatoQataricommercialportoperatingcompanyQTerminalsW.L.L.Clyde&CoandKolcuogluDemirkanKocakliadvisedthebuyer. | USD 140 million | |
22-Oct | Turkey | Pelister Atayilmaz Enkur; PwC Legal | PelisterAtayilmazEnkuradvisedGreece'sEltonGroupontheacquisitionofthefinal20%ofTurkishchemicalresellersEltonMarmaraKimyaSanayiveTicaretAnonimSirketifromtheSenlenFamily.PwCLegaladvisedthesellers. | N/A | Here |
23-Oct | Turkey | Allen & Overy; Aksu Caliskan Beygo Attorney Partnership; Durukan+Partners; Hogan Lovells; Gedik & Eraksoy; Latham & Watkins; Norton Rose Fulbright | Durukan+PartnersadvisedEmaarPropertiesPJSCanditsTurkishsubsidiaryEmaarLibadiyeGayrimenkulGelistirmeA.S.ontheamendmentoftheUSD500millionloanfacilityextendedtothembyHSBCBankplcStandardCharteredBankandEmiratesNBDBankPJSCandonthecreationofeasementrightsandperfectionofnewmortgagesassecurityinterest.HoganLovellsandNortonRoseFulbrightadvisedtheborrowersonEnglishlaw.ThelenderswereadvisedbyLatham&WatkinsandAllen&OveryonEnglishlawandbyAksuCaliskanBeygoAttorneyPartnershipandGedik&EraksoyonTuskishLaw. | USD 500 million | |
26-Oct | Turkey | Kolcuoglu Demirkan Kocakli; Schoenherr | SchoenherradvisedIstanbul-basedpaymentsoftwareproviderPaycoreonMediterraCapital'sacquisitionofamajoritystakeinthecompany.KolcuogluDemirkanKocakliadvisedthebuyer. | N/A | |
26-Oct | Turkey | Freshfields | FreshfieldsBruckhausDeringeradvisedtheEBRDSACEDEGIFCtheBlackSeaTradeandDevelopmentBankIntesaSanpaoloBaringsCreditAgricoleCIBDeutscheBankUniCreditAkbankIsbankandtheTurkishIndustrialDevelopmentBankontheEUR1.1billionrestructuringofthePPPagreementrelatedtothedevelopmentconstructionmaintenanceandoperationoftheAnkaraEtlikIntegratedHealthCampus. | EUR 1.1 billion | Here |
5-Nov | Turkey | BASEAK | TheBalciogluSelcukArdiyokKekiAttorneyPartnershipadvisedSabanciHoldingandthePPFGroupontheacquisitionbyeachofa50%stakeinTemsaUlasimAraclariSanayiveTicaretAnonimSirketi. | N/A | Here |
6-Nov | Turkey | Baker Mckenzie; Esin Attorney Partnership; White & Case | BakerMcKenzieandTheEsinAttorneyPartnershipadvisedjointglobalcoordinatorsBankofAmericaandJ.P.MorganjointleadmanagerHSBCandco-managersRadobankandRenaissanceCapitalonUlkerBiskuviSanayi'sissuanceofUSD650millionEurobondsdue2025.White&Caseadvisedtheissueronthedeal. | USD 650 million | Here |
17-Nov | Turkey | Kirkland & Ellis; Paksoy; Shearman & Sterling | PaksoyandShearman&SterlingadvisedCanada'sTelusInternationalontheUSD935millionacquisitionofLionbridgeAI.Kirkland&EllisactedaslegaladvisortoLionbridgeAI. | USD 935 million | Here |
20-Nov | Turkey | Caliskan Okkan Toker; Paksoy | PaksoyadvisedVolexonitsentranceintoaEUR61.8millionsharepurchaseagreementfortheacquisitionoftheentireissuedsharecapitalofDE-KAElektroteknikinTurkey.CaliskanOkkanTokeradvisedtheselleronthedeal. | EUR 61.8 million | Here |
1-Dec | Turkey | Akol Law Firm; Allen & Overy; Mayer Brown | TheAkolLawFirmandMayerBrownassistedTurkiyeVakiflarBankasiT.A.O.withitsissuanceofUSD750million6.500%notesdue2026underitsUSD7billionGlobalMediumTermNoteProgramme.ThejointleadMmnagerswereadvisedbyAllen&Overy. | USD 750 million | |
1-Dec | Turkey | Akol Law Firm; Baker McKenzie; Skadden, Arps, Slate, Meagher & Flom | TheAkolLawFirmworkingwithglobaladvisorSkaddenArpsSlateMeagher&FlomadvisedCotyInconTurkishlawmattersrelatedtotheglobalsaleofCoty'sProfessionalandRetailHairbusinesstoKKR.BakerMcKenzieadvisedKKR. | N/A | |
2-Dec | Turkey | Ciftci; Clifford Chance; GKC Partners; White & Case | GKCPartnersandWhite&CaseadvisedtheQatarInvestmentAuthorityonitsacquisitionofa10%stakeintheBorsaIstanbulstockexchangefromtheTurkeyWealthFundwhichretainsan80.6%stake.CliffordChanceandtheCiftciLawFirmadvisedtheTurkeyWealthFundonthetransaction. | N/A | Here |
3-Dec | Turkey | Bener Law Office; Paksoy | PaksoyadvisedchemicaldistributorIMCDonitsacquisitionoftheEjderKimyaIlacDanismanlikSanayiveTicaretpersonalcarebusinessfromPervinEjder.Beneradvisedthesellers. | N/A | Here |
4-Dec | Turkey | Akol Law Firm; Cakmak | TheAkolLawFirmadvisedPalmetEnerjiA.S.onitsacquisitionoftheentiresharecapitalofBayminaEnerjiA.S.GazkoEnerjiTicaretA.S.(itselftheownerof90%ofthesharecapitalofIzgazIzmitGazDagitimSanayiveTicaretA.S.)andEngieYonetimEnerjiHizmetleriveTicaretA.S.Cakmakadvisedthesellers. | N/A | |
14-Dec | Turkey | TOCC Attorney Partnership | TOCCAttorneyPartnershipadvisedAKLeasetheleasingsubsidiaryofTurkey'AKBankonaUSD25millionloanfromDutchentrepreneurialdevelopmentbankFMOforthefinancingofeligiblegreenprojectsinlinewithFMO'sGreenPrinciplesandCriteria. | USD 25 million | Here |
14-Dec | Turkey | Akol Law Firm | AkolLawadvisedTurkishcandyproducerKervanGidaontheinitialpublicofferingofitssharesandtheirlistingontheIstanbulStockExchange.AkolLawalsoadvisedOyakYatirimwhichactedasthebrokeronthedeal. | TL 465.7 million | Here |
16-Dec | Turkey | Kinstellar; Linklaters; Paksoy | KinstellaradvisedTurkey'sDogusHoldingonthesaleofa30%stakeinIstanbul'sIstinyeParkshoppingmalltoDoha-basedinvestmenthouseQatarHoldingLLCwhichispartoftheQatarInvestmentAuthority.LinklatersandPaksoyadvisedQatarHoldingonthedeal. | N/A | Here |
18-Dec | Turkey | Cerrahoglu; Gleiss Lutz; Somay | CerrahogluworkingalongsideleadcounselGleissLutzadvisedGelitaontheacquisitionofa65%stakeinSelJelJelatinSanayiveTicaretA.SviaGelitaInternationaleGelatineGmnHfromSelSanayiUrunleriTicaretvePazarlamaA.S.Somayadvisedthesellersonthedeal. | N/A | Here |
21-Dec | Turkey | Kolcuoglu Demirkan Kocakli; Moral & Partners; Paksoy | Moral&PartnersadvisedminorityshareholderMuratCanErtozonthesaleofCigliSuTeknolojileriAnonimSirketitheholdingcompanyoftheVansanGroupCompaniestotheEbaraCorporation.MajorityshareholderAquamanB.V.asubsidiaryofTurkvenPrivateEquitywasadvisedbyKolcuogluDemirkanKocakli.PaksoyadvisedtheEbaraCorporation. | N/A | |
22-Dec | Turkey | Paksoy | PaksoyadvisedIstanbulMetropolitanMunicipalityonitsUSD580millionbondissuance. | USD 580 million | Here |
10-Jan | Ukraine | Eversheds Sutherland; LCA Studio Legale; Nobles | NoblesandItaly'sLCAStudioLegaleadvisedDreamgroupManagementanEasternEuropeanhosteloperatoronthesaleofitshostelsinWarsawPragueandBratislavatoLondon-basedhosteloperatorSafestayplc.EvershedsSutherlandadvisedSafestayonthetransaction. | EUR 3.7 million | Here |
13-Jan | Ukraine | Eterna Law | EternaLawhelpedBalticpowertraderAxtonCommoditieslaunchitsUkrainianoperationsandobtainapowertradingactivitieslicenseinUkraine. | N/A | Here |
14-Jan | Ukraine | Baker Mckenzie; Gestors | BakerMcKenzieandAttorneys'AssociationGestorsassistedArcelorMittalKryvyiRihinananti-dumpinginvestigationregardingtheimportsofcarbonandotheralloysteelrodsoriginatingfromBelarusandMoldova. | N/A | Here |
14-Jan | Ukraine | Avellum; Latham & Watkins; Sayenko Kharenko; White & Case | SayenkoKharenkoandWhite&CaseadvisedtheJSCStateExport-ImportBankofUkraineontheissuanceofUSD100millionsubordinatedloanparticipationnoteslistedontheLondonStockExchange.Latham&WatkinsandreportedlyAvellumadvisedJ.P.MorganandMorganStanleythejointleadersonthetransaction. | USD 300 million | Here |
15-Jan | Ukraine | Asters | AstersadvisedtheEBRDonaEUR10millionfinancingtotheKormotechGroup. | EUR 10 million | Here |
17-Jan | Ukraine | Asters; Deacons | AsterssuccessfullyrepresentedASKTechnologyLimitedaHongKong-basedmanufacturerofmulti-GPUsystemsforminingrenderingandAIinadisputewithaFinnishcompanyoveracontractforthesupplyofminingequipmentintheArbitrationInstituteoftheStockholmChamberofCommerce.DeaconsprovidedHongKong-lawexpertise. | N/A | Here |
21-Jan | Ukraine | Clifford Chance; Linklaters; Redcliffe Partners | RedcliffePartnersadvisedtheEBRDonUkrainianaspectsofitsloanofanadditionaltwomillioneurostoAquanovaDevelopmentLLCfortheconstructionequipmentandplacinginoperationofa3.5MWpsolarPVplantintheZakarpattyaRegionofUkraine.CliffordChanceandLinklatersadvisedtheEBRDonEnglishandItalianlawrespectively. | N/A | Here |
21-Jan | Ukraine | Aequo; Baker McKenzie | AequoadvisedtheEpicentrGrouponitsreceiptofaUSD70millionmulti-currencysecuredloanfromtheBlackSeaTradeandDevelopmentBank.BakerMcKenzieadvisedBSTDBonthedeal. | USD 70 million | Here |
27-Jan | Ukraine | Eterna Law | EternaLawextendeditsagreementtoprovidelegalassistancetotheUkrainianTennisFederationforanotheryear. | N/A | Here |
31-Jan | Ukraine | Ilyashev & Partners | Ilyashev&PartnershelpedDruzhkovkaHardwarePlantPrJSCinitiateananti-dumpinginvestigationintoimportsofsteelfastenersfromthePeople'sRepublicofChinaintoUkraine. | N/A | Here |
31-Jan | Ukraine | Sayenko Kharenko | SayenkoKharenkoactedaslegalcounseltothewinnersofbothpilottendersfortheconcessionofUkraine'sKhersonandOlviaseaports. | N/A | Here |
31-Jan | Ukraine | Vasil Kisil & Partners | VasilKisil&PartnersadvisedLekhim-ObukhivLLContheacquisitionoftwolandplotsfromHelikomLVamanufacturerofwood-plasticcompositesintheUkrainiancommunityofObukhiv. | N/A | Here |
1-Feb | Ukraine | Avellum; Harneys Aristodemou, Loizides, Yiolitis; LK Shields; Watson Farley & Williams | AvellumactedastheUkrainianlegalcounseltotheEBRDinconnectionwithaEUR52.5millionloantoanOdessashoppingmall.TheEBRDwasalsoadvisedbyWatsonFarley&WilliamsonEnglishlawbyLKShieldsonIrishlawandHarneysAristodemouLoizidesYiolitisonCypriotlaw. | EUR 52.5 million | |
3-Feb | Ukraine | Ilyashev & Partners | ActingonbehalfofHemoplastPJSCIlyashev&PartnerspersuadedUkraine'sInterdepartmentalInternationalTradeCommissiontoinitiateasafeguardinvestigationintosyringeimportsintoUkraine. | N/A | Here |
6-Feb | Ukraine | Ilyashev & Partners | Ilyashev&PartnersisprovidingprobonoadvicetotheUkrainianRedCrossSocietyontheday-to-daybusinessactivitiesofitsorganizations. | N/A | Here |
6-Feb | Ukraine | Arzinger; Baker Mckenzie | BakerMcKenzieadvisedtheshareholdersofBiopharmaaUkrainianmanufacturerofpharmaceuticalsandhealthcareproductsonthesaleofitsnon-plasmabusinesstoStadaAG.ArzingeradvisedStadaonthedeal. | N/A | Here |
6-Feb | Ukraine | Avellum; Latham & Watkins; Sayenko Kharenko; White & Case | SayenkoKharenkoandLatham&WatkinsadvisedBNPParibasJPMorganandRaiffeisenBankInternationalasthejointleadmanagersofUkraine'sEUR1.25billionEurobondissuance.AvellumandWhite&CaseadvisedUkraine'sMinistryofFinanceontheissuance. | EUR 1.25 billion | Here |
7-Feb | Ukraine | Eterna Law | EternaLawadvisedBritishcompanySpacebitonitsattempttoperformthefirstBritishlandingonthemoon. | USD 40 million | Here |
11-Feb | Ukraine | Integrites | IntegritessuccessfullyprotectedtheinterestsofEuronetUkrainetheUkrainianrepresentativeoftheEuronetWorldwidegroupinataxdisputewiththeKyivStateFiscalService. | UAH 64 million | Here |
12-Feb | Ukraine | Clyde & Co; Kinstellar | KinstellarincoordinationwithleadcounselClyde&CorepresentedQatariportoperatorQTerminalsinitssuccessfultenderfortheportconcessionprojectinvolvingtheBlackSeaPortofOlvia. | USD 123 million | Here |
13-Feb | Ukraine | Redcliffe Partners | RedcliffePartnershelpedGECapitalthefinancialservicesdivisionofGeneralElectricobtainclearancefromUkraine'scompetitionauthorityforitssaleofthePKAirFinanceaviationlendingbusinesstoApolloGlobalManagementandAtheneHoldingLtd. | N/A | Here |
19-Feb | Ukraine | Baker Mckenzie | BakerMcKenzieadvisedtheBlackSeaTradeandDevelopmentBankonitsupUSD70millionloantoEpicentrKLLCandRenviorTradingLimited. | USD 70 million | Here |
20-Feb | Ukraine | Marchenko Partners | MarchenkoPartnersadvisedtheWesternNISEnterpriseFundonloansgrantedtoCCEDniproTrainingandProductionEnterpriseoftheUkrainianSocietyoftheBlindandthe"PrintingHouse"CenterforLaborRehabilitationofDisabledPersons. | N/A | Here |
21-Feb | Ukraine | CMS | CMSadvisedtheTISGrouponEnglishandUkrainianlawaspectsofajointventureinvolvingDPWorld'sentryintoUkraine.MarchenkoPartnersadvisedDPWorldonthedeal. | N/A | Here |
24-Feb | Ukraine | Kinstellar | KinstellaradvisedDeutscheInvestitions-undEntwicklungsgesellschaftmbHadevelopmentfinanceinstitutionandsubsidiaryofKfWBankengruppeonaUSD20millioncreditfacilityforNibulonanagriculturalcommoditiesexporterandproducerinUkraine.CliffordChance'sFrankfurtofficeadvisedDEGonmattersofEnglishlaw. | USD 20 million | Here |
25-Feb | Ukraine | DLA Piper | DLAPiperadvisedfoodchainBillaonaneight-yearleaseextensionwiththeKyivCityCouncilforBilla'sflagshipstoreinKyiv'sBessarabskyiMarket. | N/A | Here |
26-Feb | Ukraine | Redcliffe Partners | RedcliffePartnersadvisedtheEBRDonariskparticipationagreementwithPiraeusBankUkrainewithatotalvalueofEUR10million. | EUR 10 million | Here |
26-Feb | Ukraine | Everlegal | EverlegalsuccessfullyrepresentedTurkishairlineOnurAirinaclaimtorecoverUSD43million. | USD 43 million | Here |
27-Feb | Ukraine | Vasil Kisil & Partners | VasilKisilandPartnerssuccessfullyrepresentedRostAgroaUkrainian-basedseedproducerandexporterinanadministrativeappealprocedurewiththeStateTaxServiceofUkraine. | N/A | Here |
1-Mar | Ukraine | Avellum; OMP | AvellumadvisedEpicentronitsacquisitionoftheSvarogGroup.OMPadvisedtheseller. | N/A | |
1-Mar | Ukraine | Avellum; White & Case | AvellumandWhite&CaseadvisedtheUkrainianGovernmentonaloangrantedtoitbytheFrenchGovernmentfor30yearswitha10-yeargraceperiodandatarateof0.08%annualinterest.Theloanisdesignedhelpanunnamed"largeindustrialUkrainiancity"modernizeitswatersupplysystem. | EUR 64 million | |
1-Mar | Ukraine | Avellum; Kinstellar; Watson Farley & Williams | KinstellaradvisedWestSolarLLC-aprojectcompanyofSESSSolar-inconnectionwithfinancingbytheEBRD.AvellumandWatsonFarley&WilliamsadvisedtheEBRD. | EUR 4.8 million | |
1-Mar | Ukraine | Avellum; Kinstellar; Watson Farley & Williams | KinstellaradvisedSnyatinenergoinvestLLC-aprojectcompanyofSESSSolar-inconnectionwithfinancingbytheEBRD.AvellumandWatsonFarley&WilliamsadvisedtheEBRD. | EUR 5.1 million | |
4-Mar | Ukraine | Eterna Law | EternaLawadvisedtheMETGrouponitsagreementtoassistUkrenergoonthelatter'splantoreconstructitsinfrastructureinUkraine. | N/A | |
4-Mar | Ukraine | Kinstellar | KinstellarhelpedQatar-basedQTerminalsobtainmergercontrolapprovalfromtheAntimonopolyCommitteeofUkrainefortheappropriationofassetsbelongingtotheStateEnterprisesStevedoringCompanyOlviaandtheUkrainianSeaPortsAuthoritybothinMykolaivwhichenablestevedoringactivitiesintheSpecializedSeaPortOlvia. | N/A | Here |
4-Mar | Ukraine | Ilyashev & Partners | Ilyashev&PartnerssuccessfullyprotectedtheinterestsofUkrainianmanufacturersandmembersoftheUkrainianAutoclavedAeratedConcreteProducersAssociationinananti-dumpinginvestigationrelatedtoimportsofgas-concreteblocksoriginatingintheRepublicofBelarus. | N/A | Here |
5-Mar | Ukraine | Eterna Law | EternaLawadvisedtheUkrainiansubsidiaryofAIGonitsrestructuring. | N/A | Here |
5-Mar | Ukraine | Avellum; DLA Piper | AvellumadvisedarrangersJ.P.MorganSecuritiesPlcandRaiffeisenBankInternationalAGonaUSD464millionbridgeloanfinancingforBakcell'sacquisitionofPSJCVodafoneUkraine.DLAPiperadvisedBakcellonthedeal. | USD 464 million | Here |
6-Mar | Ukraine | Cai & Lenard | Cai&LenardisadvisingUkrainianteenagedancetroupeLightBalanceKidsonthenextphaseofwhatthefirmcallsits"creativedevelopment." | N/A | Here |
9-Mar | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedPromprylad.RenovationaprojectwithinthepremisesofarevitalizedSoviet-eraplantinIvano-Frankivskonitsbuying-outofplantfacilities. | N/A | Here |
12-Mar | Ukraine | Redcliffe Partners | RedcliffePartnerssuccessfullyrepresentedUkrainianmobileoperatorLifecellÊinconnectionwithaninvestigationbytheAntimonopolyCommitteeofUkraineintotheuseof28-dayservicepackagesbymobileoperators. | N/A | |
17-Mar | Ukraine | Clifford Chance; Redcliffe Partners | RedcliffePartnersandCliffordChanceparticipatedinaglobalmappingsurveyfortheUnitedNationsSpecialRapporteurforHumanRightsandtheEnvironmentrelatedtotheexistence(ornon-existence)ofafundamentalhumanrighttoahealthyenvironment. | N/A | Here |
17-Mar | Ukraine | Redcliffe Partners | RedcliffePartnersprovidedananalysisofUkrainianlaw(includingtaxlawandvariousstatutoryincentives)andotherjurisdictions'approachtosupportinggasextractionfromdepletedwellstotheUkrainianOilandGasAssociationandhelpedprepareaproposaltogovernmentalstakeholdersontaxincentivesthatUkrainecouldintroducetosupporttheuseofabandonedwellsandwellswithpoorconditions. | N/A | |
19-Mar | Ukraine | Eterna Law | EternaLawsuccessfullyhelpedPZUZyciecompleteaninsurancecaseinvestigation. | N/A | Here |
25-Mar | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedOHHoldingLimitedonthesaleofa51%stakeintheLuxopticaGroupandthecreationofajointventurewithEssilorNederlandHoldingB.V. | N/A | Here |
26-Mar | Ukraine | Avellum | AvellumadvisedtheBlackSeaTradeandDevelopmentBankonalong-termsecuredloanofuptoUSD10milliontoButsefalLLCandPrometeySwissSA. | USD 10 million | Here |
27-Mar | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedtheEBRDonitsprovisionofafour-yearloanofuptoEUR15milliontoOTPLeasing.TheloanwillbeavailablefordisbursementasUkrainianhrivnyasyntheticand/oreurodenominatedfacilities. | EUR 15 million | Here |
30-Mar | Ukraine | Asters | AstersadvisedBritishoilandgascompanyRegalPetroleumonitsacquisitionofArkonaGas-EnergyaUkrainiancompanyholdingthelicensetoexploredevelopandproducehydrocarbonsintheSvystunkivsko-ChervonolutskefieldinthePoltavaregionofUkraine. | USD 8.63 million | Here |
31-Mar | Ukraine | Avellum; Watson Farley & Williams | AvellumandWatsonFarley&WilliamsadvisedtheEBRDonalong-termsecuredloanofuptoEUR52.5milliontoNoviBiznesPoglyady. | EUR 52.5 million | Here |
1-Apr | Ukraine | Esquires Attorneys At Law | Ukraine'sEsquiresAttorneysatLawsuccessfullyrepresentedTradeandLogisticComplexArcticLLCinadisputeinvolvingtheunlawfultransferbyaformerdirectorofthecompanyofequipmentrelatedtothesupplyofelectricitytoacomplexofstorageandfoodproductionfacilitiestotheownershipofanothercompanythathewasaffiliatedwith. | N/A | Here |
1-Apr | Ukraine | Marchenko Partners | MarchenkoPartnerscompletedrepresentationofNextPLCinlitigationandthenforcementofasettlementconnectedwithprotectingitstrademarkandcopyrightagainstalocalretailer. | N/A | |
5-Apr | Ukraine | Marchenko Partners | MarchenkoPartnersrepresentedNextRetailandNextPLCinopposingbadfaithregistrationsoftrademarkssimilartoitsown. | N/A | |
7-Apr | Ukraine | Bird & Bird | Bird&BirdwonaUSD149millionjudgmentfromtheEnglishCommercialCourtforCarpatskyPetroleumCorporationasubsidiaryofKuwaitEnergyinadisputewithPJSCUkrnaftaarisingoutofajointactivityagreementrelatingtogasfieldsinUkraine. | USD 149 million | Here |
10-Apr | Ukraine | Integrites | IntegriteshelpedtheAgroGroupcompleteacompetitioninvestigationprojectinvolvingthesugarbeetprocessingmarketinitiatedbytheregionaldepartmentoftheAntimonopolyCommitteeofUkraineinthecountry'sChernihivregion. | N/A | Here |
14-Apr | Ukraine | Avellum | AvellumadvisedUkrainiandevelopmentcompanyUDPontheacquisitionofa33.35%stakeinOceanPlazaashoppingandentertainmentcenterinUkraine. | N/A | Here |
14-Apr | Ukraine | Integrites | IntegritessuccessfullydefendedtheinterestsofrenewableenergyproducerEuroCapeUkraineinadisputeagainsttheHeadOfficeoftheStateTaxServiceinUkraine'sZaporizhzhiaregion. | N/A | Here |
15-Apr | Ukraine | Marchenko Partners | MarchenkoPartnersadvisedBritishAirwaysontheappropriateprocedureforÊreducingstaffatitsrepresentativeoffices. | N/A | |
21-Apr | Ukraine | CMS; Redcliffe Partners | RedcliffePartnersadvisedUkrGasVydobuvannyainconnectionwiththerehabilitationofoilandgasreservoirsthroughtheuseofaProductionEnhancementContractwithExpertPetroleum.CMSadvisedExpertPetroleum. | USD 30 million | |
29-Apr | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedtheEBRDonitsprovisionofanup-to-EUR7.5millionsyntheticloaninUkrainiancurrencytoBankLvivundertheEU4Business-EBRDCreditLine. | EUR 7.5 million | Here |
29-Apr | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedtheEBRDonitsprovisionofafour-yearloanofuptoEUR15millionequivalenttoOTPLeasing. | EUR 15 million | Here |
30-Apr | Ukraine | Baker Mckenzie | TheKyivofficeofBakerMcKenzieassistedwithdraftingnewregulationsoftheNationalSecuritiesandStockMarketCommissionofUkrainefortheissuanceofUAH-denominatedbondsbyinternationalfinancialinstitutionsinUkraine. | N/A | Here |
30-Apr | Ukraine | KPD Consulting | KPDadvisedWernerWirthonitsestablishmentofajointventurewithanunnamedUkrainianpartnerandonmakingacross-borderintra-grouploantothejointventure. | N/A | Here |
4-May | Ukraine | CMS | CMSadvisedtheBankofCyprusonUkrainianlawmattersfollowingits2014saleoftheUkrainiansubsidiaryofBankofCyprusandassociateddebttoAlfaGroupandontherefinancingbytheEBRDofaEUR68millionfacility. | EUR 68 million | Here |
7-May | Ukraine | Marchenko Partners | MarchenkoPartnershelpedCarlsbergUkraineconductacompetitioncompliancespotcheck. | N/A | Here |
11-May | Ukraine | LCF Law Group | TheLCFLawGrouphelpedScatecSolarandPartnerslauncha54MWBoguslav-2PV-power-plantinUkraine. | N/A | Here |
11-May | Ukraine | Vasil Kisil & Partners | VasilKisilandPartnersadvisedIngersoll-RandonitsmergerwithGardnerDenver. | N/A | Here |
12-May | Ukraine | Everlegal | EverlegaladvisedUDPRenewablesonthedevelopmentandconstructionofthe20MWTerslavsolarpowerplantintheDnipropetrovskregionofUkraine. | N/A | Here |
14-May | Ukraine | Sayenko Kharenko | SayenkoKharenkosuccessfullydefendedtheinterestsofpharmaceuticalmanufacturerBayerAGbeforetheSupremeCourtofUkraineregardingapatentdisputeoverthedrugRivaroxaban. | N/A | Here |
14-May | Ukraine | VB Partners | VBPartnerssuccessfullyrepresentedtheinterestsofeducationalstart-upSkyEnginatrademarkregistrationproceedinginUkraine. | N/A | Here |
18-May | Ukraine | LCF Law Group | Ukraine'sLCFLawGroupbecamealegalpartneroftheUkrainianAssociationofRenewableEnergy. | N/A | Here |
18-May | Ukraine | Kinstellar | KinstellaradvisedUMGInvestmentsontheacquisitionofaminoritystakeinFeednovaLLCaUkrainiancompanyfocusingontheproductionoffeedadditivesforfarmanimalsandpetsandthesubsequentestablishmentofajointventurewithEffectiveInvestmentsGroupandotherstakeholdersofFeednova. | N/A | Here |
18-May | Ukraine | Vasil Kisil & Partners | VasilKisilandPartnerssuccessfullyrepresentedtheinterestsofCzechnationalVasilSadochainacaseagainstUkrainebeforetheEuropeanCourtofHumanRights. | N/A | Here |
21-May | Ukraine | Antika | Ukraine'sAntikalawfirmsuccessfullydefendedtheinterestsofthePershainsurancecompanyinadisputeinvolvingtherecoveryoffundsbysubrogation. | N/A | Here |
22-May | Ukraine | Esquires Attorneys At Law | Ukraine'sEsquireslawfirmsuccessfullydefendedtheinterestsofDiezelmashserviceKRLLCinthefirst-instanceDnipropetrovskDistrictAdministrativeCourtandthentheThirdAdministrativeCourtofAppealinaVATdisputewithUkraine'staxauthorities. | USD 100,000 | Here |
27-May | Ukraine | Integrites | IntegritesadvisedSibelcoontheacquisitionofUkrainianclayproducersEuromineralLLCandKurdyumovskyPlantPrJSC.Thesellerwasadvisedbyin-housecounselYanaPetrova. | N/A | Here |
1-Jun | Ukraine | Ilyashev & Partners | TheInternationalTradePracticeteamofIlyashev&Partnerssecuredtheintroductionofprovisionalanti-dumpingdutiesonimportstoUkraineofsteelfastenersoriginatinginthePeople'sRepublicofChina. | N/A | Here |
3-Jun | Ukraine | Asters | AstersadvisedtheEBRDonfinancingprovidedtoLantmannenAxaaproducerofbreakfastcerealsinUkrainethatisownedbySweden'sagribusinesscooperativeLantmannen. | N/A | Here |
3-Jun | Ukraine | Ilyashev & Partners | Ilyashev&PartnerssuccessfullyprotectedtheinterestsofUkrainianMatchFactoryLLCinananti-dumpinginvestigationontheimportationofmatchesoriginatingintheRepublicofBelarusandtheRussianFederationintoUkraine. | N/A | Here |
10-Jun | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedDobrobutontheacquisitionoftheDoctorSammedicalnetworkwhichoperatesthreeclinicsinKyiv. | N/A | Here |
11-Jun | Ukraine | Asters | AsterssuccessfullydefendedPrivatBankCBJSCthelargestbankinUkrainebyassetsinadefamationdisputewithO.Dubilettheformerchairmanofthebank'sboardbeforetheCivilCourtofCassationoftheSupremeCourtinUkraine. | N/A | Here |
11-Jun | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedtheEBRDonitsup-to-USD60millionsecuredloantotheFozzyGroup. | USD 60 million | Here |
11-Jun | Ukraine | Redcliffe Partners | RedcliffePartnersadvisedCitibankUkraineonanup-toUSD30millionloantoMyronivskyHliboproduct. | USD 30 million | |
17-Jun | Ukraine | Sayenko Kharenko | SayenkoKharenkosuccessfullyrepresentedtheinterestsofPJSCManufacturingAssociationStalkanat-SilurinasunsetreviewofantidumpingmeasuresagainsttheimportofwireropesoriginatingfromChinaintoUkraine. | N/A | Here |
17-Jun | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedJSCNovokramatorskyMachineBuildingPlantinasunsetreviewofanti-dumpingmeasuresagainsttheimportofcastingrollersoriginatingfromUkraineintotheEurasianEconomicUnion. | N/A | Here |
19-Jun | Ukraine | Aver Lex | AverLexpersuadedUkraine'scassationAdministrativeCourttoupholdthejudgmentsoflowercourtsthatthedismissalofUkraine'sSergeyBochkovskiyfromtheHeadoftheEmergencyServiceofUkrainewasunlawfulandgroundless. | N/A | Here |
19-Jun | Ukraine | Esquires Attorneys At Law | EsquiressuccessfullydefendedSolumLLCinadisputeoverrealestatepropertyrightsvaluedatUSD8.5million. | USD 8.5 million | Here |
22-Jun | Ukraine | Ilyashev & Partners | Ilyashev&PartnerspersuadedtheDistrictAdministrativeCourtofKyivtosuspendtheJune92020decisionoftheGeneralDirectorofUkroboronpromAivarasAbromaviciusdismissingOleksandrDonetsthepresidentoftheAntonovStateEnterprise. | N/A | Here |
22-Jun | Ukraine | Dechert; Redcliffe Partners | RedcliffePartnersandDechertadvisedScientificGamesCorporationonitsacquisitionofCome2Playacompanydevelopingnon-cashsocialgames. | N/A | |
26-Jun | Ukraine | Sayenko Kharenko | SayenkoKharenkohelpedtheEBRDprepareitsinputintoUkraine'snewlawOnAmendmentstoCertainLegalActstoFacilitateAttractionofInvestmentsandtoIntroduceNewFinancialInstruments. | N/A | Here |
1-Jul | Ukraine | Marchenko Partners | MarchenkoPartnersadvisedWesternNISEnterpriseFundonasecondloantoKyiv'sVeteranoPizzarestaurantwhichsupportsveteransofthemilitaryconflictintheEasternUkrainebyemployingthemandremitting10%ofitsprofitstofamiliesofdeceasedveterans. | N/A | |
1-Jul | Ukraine | Asters | AstersadvisedtheEBRDonaEUR25millionloantoYuria-PharmaUkrainianmanufacturerofintensivecaremedicinesmedicaldevicesandantiseptics. | EUR 25 million | Here |
3-Jul | Ukraine | Doubinsky & Osharova | Doubinsky&OsharovasuccessfullyrepresentedJackDanielbeforetheUkrainianSupremeCourtinatrademarkdispute. | N/A | Here |
6-Jul | Ukraine | CMS; Everlegal | EverlegaladvisedthefirstinnovationparkinUkraineUNIT.CityonitsreceiptofEUR50millioninfinancingfromtheEuropeanInvestmentBank.CMSadvisedEIBonthedeal. | EUR 50 million | Here |
7-Jul | Ukraine | Aequo | AequoadvisedDragonCapitalontheacquisitionofasix-storybuildinginKyiv. | N/A | Here |
8-Jul | Ukraine | | AstersadvisedtheEBRDonfinancingprovidedtotheGrainAllianceGroup. | N/A | Here |
8-Jul | Ukraine | Ilyashev & Partners | Ilyashev&PartnerssuccessfullyrepresentedJSCorrugatingMachineryCo.Ltd.intheKyivCourtofAppealswhichupheldtherecognitionandenforcementinUkraineofChinaInternationalEconomicandTradeArbitrationCommission'sUSD5millionawardinfavorofthecompanyagainstLLCSouthCardboardUkrainepluspenaltiesandarbitrationfees. | USD 5 million | Here |
16-Jul | Ukraine | Ilyashev & Partners | Ilyashev&PartnersLawFirmsuccessfullydefendedtheinterestsofUkrainianpharmaceuticalmanufacturerBiopharmainacaseinvolvingtheprotectionofcompetitioninUkraine'simmunoglobulinsmarket. | N/A | Here |
16-Jul | Ukraine | CMS | CMSadvisedtheEBRDonaloanofapproximatelyUSD13.9milliontoUkraine'sIrshanskaSESLLC. | USD 13.9 million | Here |
21-Jul | Ukraine | Baker Mckenzie | BakerMcKenziesuccessfullydefendedtheinterestsofPrandicleLimited-acompanyownedbyformerUkrainianVicePrimeMinisterandformerNaftogazCEOOlehDubyna-againstproprietaryandunjustenrichmentclaims. | N/A | Here |
22-Jul | Ukraine | Aequo | AequoadvisedAllriseCapitalInc.ontheacquisitionoftheChornomoretsstadiuminOdessafromImeksbank.ThesalewhichwasconductedbyauctionwasarrangedbytheDepositGuaranteeFund. | N/A | Here |
22-Jul | Ukraine | Asters | AstersadvisedtheIFConaUSD20millionloantoNyvaPereyaslavshchynyaUkrainianporkproducer. | USD 20 million | Here |
23-Jul | Ukraine | Redcliffe Partners | RedcliffePartnersadvisedtheEBRDonanuptoEUR25milliontermloantobeprovidedtoUkrainianStateAirTrafficServicesEnterpriseforworkingcapitalneeds. | EUR 25 million | Here |
24-Jul | Ukraine | Vasil Kisil & Partners | VasilKisil&Partners'successfullyrepresentedMcDonald'sUkraineinacaseagainsttheUkrainianLeagueofCopyrightandRelatedRights. | N/A | Here |
27-Jul | Ukraine | Integrites | IntegritesrepresentedMetroCash&CarryUkraineinadisputewithaformerenergysupplierwhofiledaclaimagainstoneofthecompany'sstoresdemandingthatitbefinedforchangingitselectricitysupplier. | N/A | Here |
27-Jul | Ukraine | Redcliffe Partners | RedcliffePartnershelpedSaudiBasicIndustriesCorporationobtainmergerclearancefromtheUkrainiancompetitionauthorityfortheUSD69.1billionsaleof70%ofitssharesbythePublicInvestmentFundofSaudiArabia-thesovereignwealthfundoftheKingdomofSaudiArabia-totheSaudiArabianOilCompany. | N/A | Here |
4-Aug | Ukraine | Avellum; Latham & Watkins; Sayenko Kharenko; White & Case | Latham&WatkinsandSayenkoKharenkoadvisedJPMorganandGoldmanSachsasthejointleadmanagersandjointdealer-managersonUkraine'ssuccessfulcompletionofthesettlementofitsnewUSD2billion7.253%Eurobonddue2033aswellasonitsfirst-everintra-dayswitchtenderofferinrelationtoitsoutstandingUSD-denominated7.75%seniornotesdue2021andUSS-denominated7.75%seniornotesdue2022.AvellumandWhite&CaseadvisedtheMinistryofFinanceofUkraine. | EUR 2 billion | |
11-Aug | Ukraine | Vasil Kisil & Partners | VasilKisil&PartnersadvisedStSophiaHomesonitsleaseofofficespaceinKyivtoGoethe-Institut. | N/A | Here |
11-Aug | Ukraine | Redcliffe Partners | RedcliffePartnersadvisedtheEBRDonaUSD27millionshort-termsecuredloantoNibulonLLCaUkrainianagriculturalcompany. | USD 27 million | Here |
12-Aug | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedtheEuropeanBankforReconstructionandDevelopmentonitsentryintothe1992ISDAMasterAgreementwiththeNationalBankofUkraine. | N/A | Here |
19-Aug | Ukraine | Baker McKenzie | BakerMcKenziesuccessfullyrepresentedBerlin-ChemieAG-themakeroftheNimesilanti-inflammatorydrug-initstrademarkchallengetotheNimesinbrand. | N/A | Here |
19-Aug | Ukraine | CMS; Redcliffe Partners | RedcliffePartnersadvisedtheYayPayfinancialtechnologycompanyontheEUR17millionsaleofamajoritystakeinthecompanytoQuadient.ThebuyerwasadvisedbyCMS. | EUR 17 million | Here |
25-Aug | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedOleksandrYaroslavskytheownerandpresidentoftheDCHgrouponhisacquisitionofallsharesofBankCreditDniprofromCyprianBrancroftEnterprisesLimited. | N/A | Here |
26-Aug | Ukraine | EY Law; Kinstellar | KinstellaradvisedQatariportoperatorQterminalsanditsUkrainiansubsidiaryQterminalsOlviaontheirentranceintoa35-yearconcessionagreementfortheOlviaportwiththeMinistryofInfrastructureofUkraineandtheUkrainianSeaPortsAuthority.EYLawadvisedtheMinistryofInfrastructureandtheSeaPortsAuthorityonthedeal. | EUR 122.9 million | Here |
31-Aug | Ukraine | Asters | AstersadvisedtheEBRDandIFConaUSD70millionloantoOJSCConcernGalnaftogazwhichoperatesachainofmorethan400fuelstationsinUkraine. | USD 70 million | Here |
31-Aug | Ukraine | GoLaw | GoLawactedasaleadcounselfortheCzechRepublic'sExportGuaranteeandInsuranceCorporationandGermany'sErsteAbwicklungsanstlatintheirUSD68milliondebtrestructuringincludingmotivatingdebtorsPJSCEurocarandLLCRICtorepaytheirloanstothecreditorsinanacceptableamount. | USD 68 million | |
1-Sep | Ukraine | Ilyashev & Partners | Ilyashev&PartnerssuccessfullydefendedtheinterestsofDanubeShippingandStevedoringCompanyLLCinadisputewiththeUkrainianSeaPortsAuthorityovertheuseoftheberthandberthinginfrastructureattheMykolaivSeaPort. | N/A | Here |
1-Sep | Ukraine | Avellum; White & Case | AvellumandWhite&CaseadvisedtheMinistryofFinanceofUkraineonaEUR250millionbilateralloanfromCargillFinancialServicesInternational. | EUR 250 million | |
4-Sep | Ukraine | Avellum; White & Case | AvellumandWhite&CaseadvisedArgusMediaLtdonitsacquisitionofAgritelInternationalwhichprovidesinformationconsultingandforecastingonagriculturalandagro-industrialmarkets. | N/A | Here |
7-Sep | Ukraine | Clifford Chance; Homburger; Redcliffe Partners | RedcliffePartnersassistedSaudiArabianchemicalcompanySabidobtainmergerclearanceinUkraineforitsacquisitionofaminoritystakeintheClariantchemicalcompany.CliffordChancewasinternationalcounseltoSabicwhileHomburgerwasinternationalcounseltoClariant. | N/A | |
8-Sep | Ukraine | Aequo | AequoadvisedRaiffeisenBankInternationalandCreativeDockonthelaunchofthe"Fairo"mobileapplication. | N/A | Here |
8-Sep | Ukraine | Asters; Integrites | IntegritessuccessfullyprotectedtheinterestsofLifelongMeditechanIndianproducerandexporterofmedicalequipmentinasafeguardinvestigationinitiatedbytheUkrainianproducerHemoplastconcerningtheimportofsyringesinUkraine.AsterssuccessfullyrepresentedtheAssociationofMarketOperatorsofMedicalDevicesandotherUkrainianimportersduringtheinvestigation. | N/A | Here |
8-Sep | Ukraine | Baker McKenzie; Sayenko Kharenko | SayenkoKharenkoadvisedtheOreximGrouponthesaleofUkraine'sEveriportterminaltoRenaiscoB.V.asubsidiaryofGlencoreAgricultureLimited.BakerMcKenzieadvisedthebuyersonthedeal. | N/A | Here |
9-Sep | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedADMBungeCargillCOFCOtheLouisDreyfusCompanyandGlencoreAgricultureonobtainingclearancefromtheAnti-MonopolyCommitteeofUkrainefortheirestablishmentofajointventure. | N/A | Here |
9-Sep | Ukraine | Sayenko Kharenko | SayenkoKharenkohelpedAbbVieInc.obtainmergerclearanceinUkrainefromthecountry'sAnti-MonopolyCommitteeforitsglobalUSD63billionacquisitionofAllerganplc. | USD 63 billion | Here |
10-Sep | Ukraine | Avellum | AvellumadvisedtheUkrainianMinistryofFinanceinconnectionwithanewmacro-financialassistanceprogramfromtheEuropeanUnion. | EUR 1.2 billion | Here |
10-Sep | Ukraine | Avellum; Sayenko Kharenko | SayenkoKharenkoadvisedJ.P.MorganonthepurchaseoftheUSD329millionEurobondtapissuebyUkraine.AvellumadvisedUkraine'sMinistryofFinance. | USD 329 million | Here |
15-Sep | Ukraine | Ilyashev & Partners | Ilyashev&PartnersinitiatedasafeguardinvestigationintotheimportofwirestoUkraineregardlessofthecountryoforiginandexportonbehalfofclientsPJSCOdesaCablePlantandPJSCYuzhkabelPlant. | N/A | Here |
16-Sep | Ukraine | Baker Mckenzie | BakerMcKenzieconductedlegalduediligencefortheStatePropertyFundofUkrainerelatedtoitsprivatizationoftheDniproHotelwhichwassoldatauctionwithawinningbidofUAH1.111billion. | UAH 1.111 billion | Here |
18-Sep | Ukraine | Asters | Astersreachedasettlementfollowingananti-dumpinginvestigationconcerningimportsintoUkraineofhotrolledseamlesssteelpipesoriginatingfromthePeople'sRepublicofChina. | N/A | Here |
21-Sep | Ukraine | Integrites | IntegritessuccessfullydefendedOrlenLietuvainadisputewiththeZhytomyrofficeoftheStateFiscalServiceofUkraine. | UAH 1.5 million | Here |
22-Sep | Ukraine | Aequo; Dentons | AequoadvisedNovusUkraineontheacquisitionoftheBillasupermarketchaininUkrainefromtheREWEGroup.Dentonsadvisedtheselleronthedeal. | N/A | Here |
23-Sep | Ukraine | Sayenko Kharenko | SayenkoKharenkoanalyzeddataprotectionregimesintheUKGermanyCaliforniaIsraelandTurkeyaspartofatechnicalassistanceprojectsupportedbyUkraine'sMinistryofDigitalTransformationandtheUSAIDCompetitiveEconomyPrograminUkraine. | N/A | Here |
24-Sep | Ukraine | Ilyashev & Partners | Ilyashev&PartnersisdefendingUkrainiantradeandeconomicinterestsinadisputebetweenUkraineandtheEUrelatingtoatemporaryexportbanonunprocessedtimber. | N/A | Here |
24-Sep | Ukraine | Redcliffe Partners | RedcliffePartnersregisteredthecopyrightforlyricswrittenbyUkrainianmusicianStanislavZolotovthatwereplacedonYouTube. | N/A | |
1-Oct | Ukraine | Ilyashev & Partners | lyashev&PartnerssuccessfullydefendedtheinterestsofMunicipalEnterpriseInternationalAirportKyivandMaster-AviaLLCinadisputeinvolvingallegationsthattheyhadactedtogethertoimproperlyrestrictcompetitionintheKyivairport'sgroundhandlingmarket. | N/A | Here |
6-Oct | Ukraine | Esquires | Ukraine'sEsquireslawfirmhelpedSkytransLLCenforceagoodstransportationagreementithadwithanunidentifiedcustomer. | USD 85,000 | Here |
8-Oct | Ukraine | Kinstellar | KinstellarhelpedtheTurkeyWealthFundobtainmergercontrolapprovalfromtheAntimonopolyCommitteeofUkrainefortheacquisitionofacontrollinginterestinTurkcellIletisimHizmetleriA.S. | N/A | Here |
8-Oct | Ukraine | Arzinger | ArzingerassistedwithWaterEmpireUkraine'ssuccessfulappealofadecisionoftheAntimonopolyCommitteeofUkraineinvolvingthecompany'sallegedmarketviolations. | UAH 2.7 million | Here |
8-Oct | Ukraine | Arzinger | ArzingeradvisedtheIFConaloantoOTPLeasinginUkraine. | USD 50 million | Here |
9-Oct | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedthePowerConstructionCorporationofChinaLtd.onmattersrelatedtotheconstructionofthe245.7MWSyvashWindFarminUkraine. | N/A | Here |
12-Oct | Ukraine | Redcliffe Partners | RedcliffePartnersadvisedUkrainianHRtechproductmanufacturerHurmaSystemonseedfinancingfromEuropeanventurecapitalfirmPragmatechVentures. | N/A | Here |
13-Oct | Ukraine | Vasil Kisil & Partners | VasilKisil&PartnerssuccessfullyrepresentedtheinterestsoftheReleconstructioncompanyinadisputewiththeKyivCityCounciloveritsfailuretorecognizeRele'stransferoftherighttouseland. | N/A | Here |
13-Oct | Ukraine | DLA Piper; Sayenko Kharenko | SayenkoKharenkoadvisedMyrwaytonHoldingLimitedonitssaleofanunspecifiedrailwayoperatortoRenaiscoasubsidiaryofGlencoreAgriculture.DLAPiperadvisedthebuyeronthedeal. | N/A | Here |
20-Oct | Ukraine | Allen & Overy; Avellum; Linklaters; Sayenko Kharenko | SayenkoKharenkoandLinklatershaveadvisedjointbookrunnersDeutscheBankNatixisIMIIntesaSanpaoloandRaiffeisenBankInternationalonMetinvest'sUSD333millionEurobondissue.Allen&OveryandAvellumadvisedMetinvest. | EUR 333 million | Here |
27-Oct | Ukraine | Integrites | IntegritessuccessfullyrepresentedtheinterestsofAKWUkrainianKaolinCompanybeforetheAntimonopolyCommitteeofUkraineregardinganallegedinfringementbytherailoperatorintheVinnytsiaregionofUkraine. | N/A | Here |
27-Oct | Ukraine | CMS | CMSadvisedINGBankN.V.onrestructuringthefinancingfacilityfortheViOilGrouptoreflectchangesinViOil'scorporatestructure. | N/A | Here |
28-Oct | Ukraine | Arzinger | ArzingerconvincedtheBoardoftheAppealsChamberofUkraine'sMinistryofEconomicDevelopmentTradeandAgriculturetorecognizethe"lifecell"trademarkaswell-knowninUkrainetherebyofficiallyconfirmingthe"highpositionofthelifecellbrand"inthetelecommunicationsservicesmarket. | N/A | Here |
28-Oct | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedElementumEnergyonitsacquisitionoftheminoritystakeinthejointventurecompanyEEhadenteredintowiththeVolterraEnergyGroup. | N/A | Here |
30-Oct | Ukraine | Akin Gump; Allen & Overy; Asters; Clifford Chance; Redcliffe Partners | RedcliffePartnersandCliffordChanceadvisedED&FManTreasuryManagementplcthetreasurymanagementarmofED&FManaUK-basedinternationalcommoditiestraderonUkrainianlawaspectsontherefinancingandrestructuringofnearlyUSD1.5billionofdebtandraisinganextraUSD320millioninworkingcapital.Allen&OveryandAkinGumpStraussHauer&Feldadvisedtheschemecreditorsandnote-holdersrespectivelyandAstersadvisedtheunidentifiedlendersonUkrainianlawaspectsofthedeal. | EUR 1.82 billion | Here |
2-Nov | Ukraine | Hillmont Partners | HillmontPartnerssuccessfullydefendedtheinterestsofDeltaWilmarUkraineinadisputewiththeStateEnvironmentalInspectorateofUkraine. | N/A | Here |
2-Nov | Ukraine | Sayenko Kharenko | SayenkoKharenkohelpedtheUkrainianParliamentformastrategytoobtainrecognitionfromtheEUCommissionthatUkraineprovidesadequateprotectionofpersonaldata. | N/A | Here |
5-Nov | Ukraine | Asters | AstershelpedtheTabletochkiFundorganizetheDobroRuncharityraceinvolvingover1200individualsfromUkraineand16othercountries. | N/A | Here |
6-Nov | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedWindFarmLLConitsentryintoanengineeringprocurementandconstructionagreementwithPowerchinaforthejointdevelopmentofan800megawattwindfarmintheDonetskregioninUkraine. | N/A | Here |
6-Nov | Ukraine | Ilyashev & Partners | Ilyashev&PartnerssuccessfullyrepresentedChallengingShippingLtd.initsappealofadecisionoftheStateEcologicalInspectionofUkraineimposinganadministrativepenaltyontothecaptainofoneofitsshipsNewChallengeforcontaminatingtheharborwatersintheMykolayivseaport. | UAH 13.5 million | Here |
10-Nov | Ukraine | DLA Piper | DLAPiperadvisedTechHostingLLContheleaseof7656squaremetersofofficespacetoserveasthecompany'snewco-workingspace. | N/A | Here |
11-Nov | Ukraine | Marchenko Partners | MarchenkoPartnersadvisedtheWesternNISEnterpriseFundonaloantoWalnutHouseabakerybasedinLvivUkraine. | N/A | Here |
11-Nov | Ukraine | Ilyashev & Partners | Ilyashev&PartnersworkingprobonoonbehalfoftheUkrainianRedCrossSocietypersuadedalargenetworkofmedicalcentersinUkrainetodiscontinueitsunauthorizeduseoftheRedCrossemblem. | N/A | Here |
16-Nov | Ukraine | CMS | CMShelpedthePrimoCollectGroupsecuretheapprovaloftheNationalBankofUkraineforitsacquisitionofasubstantialinterestintheKredyt-KapitalLLCfinancialinstitution. | N/A | Here |
16-Nov | Ukraine | Integrites | IntegritessuccessfullydefendedtheinterestsofDominonianItalianmanufacturerofagriculturalmachineryinanunfaircompetitionclaimmadetotheAntimonopolyCommitteeofUkraine. | N/A | Here |
19-Nov | Ukraine | Asters | AstersadvisedtheEBRDonitsEUR3.3millionloantotheKormotechGroup. | EUR 3.3 million | Here |
20-Nov | Ukraine | Eterna Law | EternaLawhelpedtheWarChildhoodMuseumprojectopenamuseuminUkraine. | N/A | Here |
23-Nov | Ukraine | Aequo | AequosuccessfullydefendedtherightsofUkraine'sDarnitsapharmaceuticalcompanytothesharesoftheBorshchahivskiychemical-pharmaceuticalplantintheSupremeCourtofUkraine. | N/A | Here |
23-Nov | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedtheEBRDonitsprovisionofaUSD100millionsecuredfinancingpackagetoNovus. | EUR 100 million | Here |
24-Nov | Ukraine | CMS | CMSadvisedDiscoveryLifeSciencesaUS-basedbio-specimengenomicsequencingcellandimmunohistochemistryservicesfirmonitsacquisitionofEastWestBiopharmaaUkraine-basedhumanbio-specimensolutionsorganization. | N/A | Here |
24-Nov | Ukraine | Asters | AsterssuccessfullyrepresentedtheGlobusshoppingcenterinadisputewiththeUkrainiantaxauthority. | UAH 300 million | Here |
26-Nov | Ukraine | Asters | AstersadvisedNaftogazEnergoserviceontheconstructionofa33megawattsolarpowerplantinChudnivUkraine. | N/A | Here |
27-Nov | Ukraine | Antika | AntikaLawFirmsuccessfullyassistedUkrainianinsurancecompanyPershawithitsclaimforreimbursementoflegalfeesfromapreviousdispute. | N/A | Here |
27-Nov | Ukraine | Redcliffe Partners | RedcliffePartnerssuccessfullyrepresentedLightConverseLtdinadisputeregardingthecancellationoftheLightconverseandLCtrademarksduetonon-use. | N/A | |
27-Nov | Ukraine | Asters | AsterssuccessfullydefendedPrivatBankCBJSCinadisputewiththeBukovelSkiResortheardbytheCommercialCourtofCassationoftheSupremeCourtofUkraine. | UAH 7.5 billion | Here |
30-Nov | Ukraine | Ilyashev & Partners | Ilyashev&PartnerssuccessfullyprotectedtheinterestsofKarpatnaftochimLLCinasafeguardinvestigationregardingtheimportofpolymericmaterialstoUkraine. | N/A | Here |
30-Nov | Ukraine | Redcliffe Partners | RedcliffePartnerssucessfullyrepresentedOntarioInc.beforethePatentOfficeofUkraineregardingthefilinganoppositiontoatrademarkapplication. | N/A | |
30-Nov | Ukraine | Sayenko Kharenko | SayenkoKharenkosuccessfullyrepresentedtheinterestsoftheAuchanGroupinacaseinvolvingtheillegalalienationoflandplotsbelongingtoitintheOdessaregionofUkraine. | EUR 10 million | Here |
30-Nov | Ukraine | Dentons | DentonsadvisedInnovatusCapitalPartnersonaUSD10millionpre-exportsecuredfacilitytoanunidentifiedgroupofcompaniesdealingwithproducingandtradingofgrainsoilseedsandbyproductsofoilseedsandotherfarmingservices. | USD 10 million | Here |
1-Dec | Ukraine | Ilyashev & Partners | Ilyashev&PartnersrepresentingtheinterestsofOBIOLLCpersuadedUkraine'sInterdepartmentalCommissiononInternationalTradetoinitiateananti-dumpinginvestigationoftheimportofheat-insulatingmaterialstoUkrainefromtheRepublicofBelarusandtheRussianFederation. | N/A | Here |
1-Dec | Ukraine | Esquires Attorneys at Law | EsquiressuccessfullyreversedtheseizureofimmovablepropertyonbehalfofEntertainmentCenterofSportahotelandentertainmentcomplexwithatotalareaofmorethan3.500squaremeterslocatedinthesuburbsofKyiv. | N/A | Here |
1-Dec | Ukraine | Avellum; Latham & Watkins; Sayenko Kharenko; White & Case | AvellumandWhite&CaseadvisedtheMinistryofFinanceofUkraineonaUSD600milliontapissueofUkraine'soutstandingUSD2billion7.253%notesdue2033.Theadditionalissuancewaspricedata6.20%yield.SayenkoKharenkoandLatham&WatkinsadvisedjointleadmanagersBNPParibasandGoldmanSachsInternational. | USD 600 million | |
1-Dec | Ukraine | Avellum; Clifford Chance | AvellumandCliffordChanceadvisedJointStockCompanyTheStateExport-ImportBankofUkraineandGoldmanSachsInternationalasdealermanageronTheStateExport-ImportBankofUkraine'sUSD316millioncashtenderoffer. | USD 316 million | |
1-Dec | Ukraine | Avellum; Clifford Chance; Sayenko Kharenko; White & Case | AvellumandWhite&CaseadvisedtheMinistryofFinanceofUkraineonatermloanfacilityfromDeutscheBankAGtobeusedforgeneralbudgetarypurposestocovershort-termliquidityneeds.SayenkoKharenkoandCliffordChanceadvisedDeutscheBank. | USD 350 million | |
1-Dec | Ukraine | Avellum | AvellumactedasÊUkrainianlegalcounseltoBSTDBonitsprovisionofaEUR30millionloantoUkrgasbanktopromotefinancingforenvironmentallyfriendlyprojectsandtohelpUkrainiansmallandmedium-sizedenterprisesrecoverafterthepandemiccrisis. | EUR 30 million | |
4-Dec | Ukraine | Ilyashev & Partners | Ilyashev&Partnerssuccessfullychallengedthearrestof50.3%ofthesharesofFerrexpoPoltavaMiningownedbyFerrexpoAGSwitzerland. | N/A | Here |
4-Dec | Ukraine | Aequo | AequohelpedEstonia'sSupplierPlusGroupOUlaunchSupplierPlusasupplychainfinancesolutioninUkraine. | N/A | Here |
9-Dec | Ukraine | Aequo; KPMG Legal | AequoadvisedDragonCapitalontheacquisitionofIndustrialParkRyasne-2fromEuropeanindustrialparkdeveloperCTP.KPMGUkraineadvisedCTPonthedeal. | N/A | Here |
11-Dec | Ukraine | Asters | AstersadvisedtheEBRDonitsissuanceofaloantoUkraine'sEnzymyeastmanufacturer. | EUR 10 million | Here |
11-Dec | Ukraine | Everlegal; Integrites | IntegritesadvisedJSBUkrgasbankonaEUR50milliondealwithUFuturetofinanceitsUNIT.CityprojectinUkraine.EverlegaladvisedUFutureonthedeal. | EUR 50 million | Here |
15-Dec | Ukraine | Avellum | AvellumhelpedLVNLimitedobtainclearancefromtheAntimonopolyCommitteeofUkrainefortheprivatizationofapartoftheassetsofUkrspyrt-Ukraine'sstate-ownedproducerofalcoholandliquor. | N/A | Here |
15-Dec | Ukraine | Asters; Bryan Cave Leighton Paisner; Everlegal | EverlegaladvisedNovopecherskaSchoolonaEUR10millionloanagreementwiththeBlackSeaTradeandDevelopmentBankfortheconstructionofaschoolintheUNIT.Cityinnovationpark.BryanCaveLeightonPaisnerandAstersadvisedBSTDBonthedeal. | EUR 10 million | Here |
21-Dec | Ukraine | Ilyashev & Partners | Ilyashev&PartnerssuccessfullyrepresentedChina'sJ.S.CorrugatingMachineryCo.Ltd.initsrequestthatUkraine'sSupremeCourtenforceanarbitralawardissuedonitsbehalfbytheChinaInternationalEconomicandTradeArbitrationCommissionfortherecoveryofoverUSD5millionfromUkrainiandebtorSouthCardboardLLC. | USD 5 million | Here |
23-Dec | Ukraine | Doubinsky & Osharova | ActingonbehalfofUkraine'sThreeBearsicecreamcompanyDoubinsky&OsharovapersuadedUkraine'sNorthernCommercialCourtofAppealtoupholdthedecisionoftheCommercialCourtofKyivthatthedesignation"KASHTAN"hadbecomecommonlyusedandthusqualifiedas"generic." | N/A | Here |
23-Dec | Ukraine | SDM Partners | SDMPartnerssuccessfullyrepresentedtheinterestsofWrigleyUkraineinataxdisputevaluedatUAH28million. | UAH 28 million | Here |
24-Dec | Ukraine | Aequo | AequoadvisedOnitontheacquisitionofAxdraftaYCombinator-backeddocumentautomationcompany. | N/A | Here |
24-Dec | Ukraine | Doubinsky & Osharova | Doubinsky&OsharovasuccessfullyrepresentedtheinterestsofJackDaniel'sinacassationappealmadebyStrongdrinkLLCtotheSupremeCourtofUkraine. | N/A | Here |
24-Dec | Ukraine | Arendt & Medernach; Avellum; Borel & Barby; Latham & Watkins; Linklaters; Sayenko Kharenko | SayenkoKharenkoandLatham&WatkinsadvisedjointleadmanagersCreditAgricoleJ.P.MorganandNatixisontheUSD300million7-year6.75percentEurobondissuebyKernel.TheissuancewascoupledwithatenderoffertotheholdersofKernel'sexistingUSD500million5-year8.75percentEurobondduein2022.AvellumadvisedKernelonUkrainianaspectsoftheissuancewithLinklatersadvisingonmattersofEnglishandUSlawArendt&MedernachonLuxembourglawandBorel&BarbeyonSwisslaw. | USD 300 million | Here |
24-Dec | Ukraine | Marchenko Partners | MarchenkoPartnersadvisedEnergoGroupontherestructuringofitsapproximatelyUSD1billiondebtunderaPXFfacilitygrantedin2013byasyndicateconsistingamongothersofINGBankN.V.UniCreditBankAGVTBBankSAandRaiffeisenBankInternationalAG. | USD 1 billion | |
29-Dec | Ukraine | Aequo | AequoadvisedtheEBRDonaUSD10millionloantoagribusinessoperatorAstarta. | USD 10 million | Here |
29-Dec | Ukraine | Sayenko Kharenko | SayenkoKharenkoadvisedtheEBRDonaEUR25millionfinancingtoOTPLeasingtosupportmicrosmallandmedium-sizedenterprisesinUkraine. | EUR 25 million | Here |
30-Dec | Ukraine | Aequo | AequosuccessfullydefendedtheintellectualpropertyrightsoftheDarnitsaPharmaceuticalcompanytotheCitramontrademarkinUkraine. | N/A | Here |